SlideShare a Scribd company logo
1 of 44
Download to read offline
Revision Essay
Crafting an essay on the topic of "Revision Essay" can prove to be a challenging endeavor. The
complexity lies in the intricate balance one must maintain between self-reflection and
constructive critique. When tasked with revising one's own work, a writer must navigate the fine
line between acknowledging the strengths of the initial draft and recognizing areas that warrant
improvement. It involves a critical examination of the clarity of ideas, the coherence of
arguments, and the overall effectiveness of the communication.
The difficulty intensifies as one grapples with the inherent bias that comes with being the author
of the original piece. It requires a degree of detachment to objectively assess the work and
identify weaknesses without succumbing to the temptation of overlooking flaws. This self-
critical analysis demands a certain level of humility and openness to constructive feedback, often
pushing the writer out of their comfort zone.
Furthermore, the process of revising an essay necessitates a keen eye for detail. Sentence
structure, grammar, punctuation, and overall writing style must be scrutinized meticulously. The
challenge lies not only in recognizing these nuances but also in implementing changes effectively
to enhance the overall quality of the composition.
Moreover, the revision process can be mentally taxing. It requires the writer to revisit their ideas,
confront potential shortcomings, and invest the time and effort needed for substantial
improvement. This introspective journey demands patience, persistence, and a commitment to
refining the work until it reaches its full potential.
In conclusion, the difficulty of writing an essay on the topic of "Revision Essay" arises from the
delicate balance between self-reflection and constructive critique, the challenge of objectivity
when evaluating one's own work, the need for attention to detail, and the mental effort required
to navigate the revision process. It is a task that demands not only writing prowess but also a
willingness to embrace the challenges of self-improvement.
If you find yourself grappling with such challenges or require assistance with various types of
essays, consider exploring the services offered by HelpWriting.net. There, you can access a
range of writing solutions tailored to your needs, ensuring that your academic or professional
writing endeavors receive the support they deserve.
Revision Essay Revision Essay
Passing Essay
The Root of Jealousy
In Nella Larsen s Passing, Irene Redfield and Clare Kendry show us a great deal
about race and sexuality in the 1920s. Both are extremely light skinned women of
African American descent. However similar they appear to be, their views on race, a
very controversial issue at the time, differ significantly. Clarechooses to use her
physical appearance as an advantage in America s racist and sexist society, leaving
behind everything that connects her to her African American identity. She presents
herself as an object of sexual desire, flaunting herself to gain attention. Irene is
practically the opposite, deciding that she wants to remain with the label of being
black. She is subtle with her ... Show more content on Helpwriting.net ...
When Irene finally realizes that this woman is Clare, someone who chooses to
pass and hide all traces of her black heritage, Irene s opinion of her changes. She no
longer wants to be involved with Clare in any way, and had no desire or intention
of making the slightest effort about Tuesday. Nor any other day for that matter.
She was through with Clare Kendry. (p. 31) Irene is appalled that someone can so
easily throw away her background just for the sake of gaining privilege over
another race. When Clare asks her if she had ever thought of passing, Irene replies,
No. Why should I? You see, Clare, I ve everything I want. (p. 28) She is happy
with what she has, not even having to give up anything to get there. Or at least
that s what she convinces herself to believe. Irene is again hypocritical in her
beliefs. Even when she opposes Clare s view of passing, she is still very interested
in the idea. The truth was, she was curious. There were things she wanted to ask
Clare Kendry. She wished to find out about this hazardous business of passing ...
(p. 24) She even admitted that she held for her a fascination, strange and
compelling. (p. 28) Irene doesn t seem to be able to decide if she accepts passing
as reasonable. She forces herself to disagree with passing, allowing her to hate Clare
for doing it. This shows us that sexuality and race are two matters that conflict with
each other, at least in Irene s opinion. She uses race to
Sundiata An Epic Of Old Mali Summary
The sacred traditions, customs, and beliefs of ancient Mali is a story of epic
proportions. To retrieve the great lineage of the First Kings of Mali and learn the
history behind certain rituals told by an exquisite narrative that is perfectly woven
together through different stories. The legend of Sundiata stresses the importance of
understanding and respecting one s history. In D. T. Niane s Sundiata An Epic of Old
Mali, the African history of Mali is presented through tribal customs, honor, and
jealousy between brothers.
Years and years ago in Africa, certain customs and traditions were set in place that
governed different regions and tribes. People in Mali had a unique tradition bearer.
In the first chapter of Niane s Sundiata An Epic of Old Mali, the reader is
introduced to a griot who explains his role and his ancestor s knowledge on
ancient Mali. The art of eloquence has no secrets for us; without us the names of
kings would vanish into oblivion,... by the spoken word we bring to life the deeds
and exploits of kings for younger generations. (Page 1) In a humble but guaranteed
tone, the griot assures the reader that he is the keeper of all. His knowledge expands
beyond what is now and covers what has been. Everything that has occurred in the
kingdom of Mali is imperative for the griots to remember so the future kings would
understand their heritage. They are the overseers of knowledge and without them
there is no way the kings of Mali would have flourished.
Makeup Is The Most Popular Eye Makeup
Makeup has been around for over 10,000 years because women have always strived
to make themselves perfect. Makeup is cosmetics such as lipstick or powder applied
to the face and is used to enhance or alter the appearance.Over the years the use of
makeup has been used for many things other than enhancing a womans natural
beauty. Women wear makeup to look more appealing and boost their confidence
rather than wearing it for a man. For instance eye makeup was onced used for
getting rid of spirits and better sight according to makeup enhance. According to
makeup enhance black and green was the most popular eye makeup colors. They
decorated their eyes by applying dark green to the under lid and using kohl to
outline the eyes, creating that alluring almond eye look ( Makeup Enhance). This
is an example of makeup being used for other purposes rather than for what people
think the only reason is which is to Look beautiful. When all women are already
beautiful. Lipstick has been around for many decades. Lipstick is a waxy solid
usually colored cosmetic in stick form for the lips (Merriam Webster). Egyptians
had used two ingredients that are extremely deadly when combined together. Soon
the lipstick had became known as the kiss of death . However they continued using
the color to get red lips. Damien Gayle, author of Why red lips can make a woman
look younger , found that the redness of lips decreases with aging. Red lips Over the
years women has turned to
My Strenght and Weaknesses as a Leader
At twenty three, Carly Fiorina had dropped out of UCLA Law School with no
plans about what she wanted to do with her future. However, almost twenty two
years later, she became president and CEO of Hewlett Packard Company the first
woman CEO of a Fortune 20 company. She was given a mandate by HP s board of
directors to shake things up and was later named the Most Powerful Woman in
Business by Fortune magazine. Prior to joining HP, Fiorina spent nearly twenty
years at AT T and Lucent Technologies, where she held a number of senior
leadership positions (Cara Carleton Fiorina. (2014). In 1999, Hewlett Packardhired
Carly Fiorina, former senior executive of Lucent Technologies, as its Chief Executive
Officer. Carly brought nearly... Show more content on Helpwriting.net ...
She could not delegate or relate to her employees and without followers there can be
no leader.
The aspects of Traits theory that are relevant to Carly Fiorina can be summarized as
two styles that were exhibited by her at HP: Achievement Oriented and Ambition.
Fiorina s past achievements in business and her well known reputation for being
ambitious were among the reasons she was hired by the Board in their desire to turn
the company around. For example, she faced greater challenges than most CEOs in
having to guide HP through a merger of computer maker Compaq, the acquisition
culminating in 2002. It is identified that she was over ambitious in her leadership.
A Leader wanting to grow the company is to be admired, but sometimes a company
s culture and resources place practical limits on growth, especially in the short
term. Fiorina was caught in the middle; she could not grow revenues and profits
quickly enough to meet the Board s expectations. Concerning Path goal theory: In
Fiorina s case 3 types can be identified: directive style, participative style, and
achievement oriented style. As an example of the directive style, in early 1996,
Fiorina stayed up all night with Lucent Comptroller, Jim Lusk, and other employees
to make sure the prospectus for a stock offering was perfect. Concerning participative
style, Fiorina imposed reorganization on HP but failed to adequately delegate
Procedures For Support The Assessment Of Units And The...
16. ASSEMENT
16.1. Have the staff, resources and systems necessary to support the assessment of
units and the award, accumulation and transfer of credits and, where necessary, the
recording of exemptions.
16.2 Have arrangements in place that allow for recognition of prior learning (RPL)
(where appropriate).
17.0 TERM AND TERMINATION
17.1 A Centre approval license granted under this agreement shall, subject to earlier
termination in accordance with this agreement, continue for a minimum period of
three years from the date upon which it is granted and shall continue thereafter until
termination by either party giving to the other not less than six month notice in
writing, such notice to expire on an anniversary of the date on which the Centre
approval license was granted.
17.2 Approval of any approved course shall, subject to earlier termination in
accordance with this agreement, continue for a minimum period of three years from
the date upon which the approval is granted and shall continue thereafter until
termination by either party giving to the other not less than six month notice in
writing, such notice to expire on the anniversary of the date on which the approval
was granted.
17.3 Assetв„ў may terminate the Centre approval license and/or the approval of any
and all approval courses forthwith by notice in writing if the Centre is in breach of
this agreement and shall have failed to remedy the breach (where the breach is
capable of remedy)within 30 days of receipt of
Evil Within the World, Depicted in J.R.R. Tolkien s The...
Since the dawn of time, mankind has been plagued with the ever existing evils of
the world. From the first murder by Cain to the opening of Pandora s Box, the
concept of evil has permeated itself into the societies and cultures of the world
throughout time. However, in a world of darkness we stand not alone. For wherever
evil dwells, the forces of good are always likewise present to maintain the balance:
right? In today s western world we often take this widely accepted belief for granted.
After all, for every super villain there is always a hero, and for every damsel in
distress there is always a happy ending, or at least that is what the media would
have you believe. What I begin to see as I delve further in to the concept of good and
... Show more content on Helpwriting.net ...
In a setting so contaminated by the evils of the world, how could an innocent little
hobbit actually emerge as a character that has truly progressed for the better as most
think? This brings us to the final impending question. Is there truly good in the world
according to J.R.R. Tolkien in The Hobbit? This idea of good in the world has often
been explored within countless pieces of literature and has marked itself as a truly
meaningful concept to be evaluated. The main questions spurring from this
concept, which are often explored, usually concern the presence of good and evil
within a situation or setting. Building upon this I myself have chosen the concepts
of good and evil for which I am to base my milieu. This milieu is to be expanded
upon in my evaluation of The Hobbit and will be explored in terms of presence and
sense of conformity to both the Boethian and Manichaean ideologies. I have
chosen these specific ideologies to focus on for the reason that they represent both
sides of an ongoing argument concerning the status of good in the world and
therefore offer a fair balance to each other. The Boethian notion of good, in my
opinion, asserts that the only working force within the world is that of good, and
that what most perceive as evil is simply the absence of good. The Manichaean
ideology (as previously mentioned) seems to be more of a modern interpretation of
the working forces in the world. This ideology asserts that good and
Virginia Beach s Offshore Wind Farm Solution Essay
Virginia Beach, Virginia is making strides toward cleaner energy production,
despite the threat of a coal fired power plant. Coal fired power plants, such as the
Cypress Creek Power Station intended to be built in Surry County, Virginia, are
environmentally harmful yet most cities are continuing to depend on them for a
reliable and steady output of energy. This local environmental issue is a dilemma
that many cities throughout the world are also experiencing. My study
demonstrates how cities faced with these predicaments can find practical solutions
for providing energy while being environmentally friendly. Scientific research along
with the analysis of two scholarly articles explain the threats of coal fired power
plants on humans health and the environment as well as the advantages and
disadvantages of practical solutions. Based upon proven facts and research, I have
provided my opinion that Virginia Beach s offshore wind farm solution is a suitable
choice for that specific geographic region. What is not a suitable solution is the
natural gas fueled power plant that is currently in the process of being constructed. In
conclusion, this study demonstrates that there is no one size fits all solution to
providing energy. Air Pollution in Virginia Beach; an Environmental Issue An
environmental issue affecting the city of Virginia Beach, VA is the production of a
coal fired power plant. In 2008, the local power company, Old Dominion Electric
Cooperative (ODEC), started
The Effect Of Acid Concentrations Increases Permeability...
Change in pH concentrations increases permeability of beetroot (‎Beta vulgaris)
cell membranes indicated through color intensity using the spectrophotometer
Joshua Elekwa
Introduction to cell Biology, Fall 2014
Mount Royal University
ABSTRACT
The cell membrane (Plasma membrane) functions to provide cell support, cell
stability and control entry and exit of materials from the cell. This study was
conducted to test the effects of environmental conditions such as the on beet root cell
membrane (Beta vulgaris). Five trials using varied pH concentrations were tested and
absorbance rates were monitored. The experimental results showed that the protein
function decreased sequentially when the pH decreased. This allowed the betacyanin
dye to leak out which created the color that was needed to determine the intensity and
therefore the effect of the circumstances. This supported the hypothesis that the more
acidic or basic the environmental condition around the beet cell, the more permeable
the, membrane indicated by color intensity. Pigment leakage in the solution was
analyzed by using a spectrophotometer.
INTRODUCTION
Plant cells have selectively permeable membrane that allows selective substances to
penetrate into the cell. Cell membranes are consisting of lipid layer that are made up
of phospholipids. (Essays, UK.2013). These phospholipids are amphipathic in nature,
which have phospholipids head and tail respectively. Phospholipids heads are
hydrophilic and tails
Timing Of Events In Romeo And Juliet Essay
Often in life, tragedies that occur have a lot to do with the bad timing of events. In
William Shakespeare s play The Tragedy of Romeo and Juliet, two teenagers who
live in the beautiful city of Verona, Italy fall madly in love at first sight. The problem
with this is that their families, the Montagues and the Capulets, have been feuding for
centuries. After a secret marriage, the two lovers are separated because of the actions
of their families. The play tragically ends with the married couple committing suicide
because of imperfect timing and confusion. Throughout this play, timing continuously
plays a major role in all of the characters actions, eventually leading to tragedy. In the
beginning of this play, drama and conflict are caused by flaws in timing of events....
Show more content on Helpwriting.net ...
After Juliet and Friar Lawrence make their plan to fake Juliet s death, she tells her
father she will agree to marry Paris. Ecstatic with her agreement, her father
responds, Send for the county go tell him of this. I ll have this knot knit up
tomorrow morning ( 4.2. 23 24). Capulet has just changed the date of the wedding.
This leaves a very short amount of time to inform Romeo on Friar and Juliet s plan.
Also, in Act 5 Juliet has already taken the sleeping potion. Everyone thinks she is
dead including Romeo. Romeo arrives at Juliet s tomb, then after seeing her,
drinks the poison to kill himself. When Juliet awakens, Friar Lawrence is there
and she discovers Romeo s dead body. Juliet grabs a dagger and says, Yea, noise?
Then I ll be brief. O happy dagger! This is thy sheath; there rust, and let me die (5.3.
169 170). This reveals that timing has just caused these two deaths. If Romeo
would have known about the plan, if Friar would have arrived to the tomb earlier,
or if Juliet would have awakened the two would still be alive. Two star crossed
lovers committed suicide because of terrible timing of
Essay about Hook Up Culture
College and universities have made great strides over the years. The campuses have
grown, and the resources have improved tremendously. However, it is questionable
if that social scene on these campuses has changed for the better over the years.
Work hard, party hard has become the motto of college students to live by. Students
spend the week focused on their academics, striving to grow as intellects. However,
the weekend becomes the time when students look to go out and socialize at the
various parties. And this is exactly what the weekend is for. With growing causal
party scenes, college students have been more inclined to have a casual relationship
with the opposite sex. Traditional dating on college campuses is rarely seen anymore
... Show more content on Helpwriting.net ...
Boston College freshmen, Caroline Gray says, I think college kids are under a
false conception that they have to hook up with as many people as they can to have
a good time, when I believe that we can get more satisfaction out of caring and being
cared for and by one person. So, what happens when someone desires something
more?
The majority of the time the person who is left longing for more than just a casual
hookup is the female. Women, by nature, are more likely to become more
emotionally attached, especially when it comes to sexual activities. However,
most of the time, girls will be willing to play along with the game of hooking up.
Perhaps, in hopes, that it will someday lead to something more. But, if and when it
doesn t, they can be left emotionally distraught. Girls will become attached to the
person they are with and grow to have a sincere care for them. However, when it
comes to picking a mate, boys are not as particular about the girl. A study, Age and
gender differences in mate selection criteria for various involvement levels found
that men should be equally as selective as women with respect to long term mates,
but less selective than woman with respect to short term mates criteria (Kenrick).
Boys are less likely to think about all aspects of girl when planning on hooking up
with her, unlike girls. They are not as particular because they are just looking for
Chocolate Art Research Paper
Chocolate art!! Yep this week we are combining two of my favorite things
chocolate and art. Before I explain the process to this I have to admit working with
chocolate is not easy. I used chocolate chips if you recreate this you may want to
use any melts that you can find at the craft store. Candy melts are a lot less
temperamental than chocolate and you will have a better finished product than I
did. I was trolling through Pinterest and I found this I how much fun it would be to
recreate this cake in honor of my family on valentines day. You could also use this
same method to recreate some pictures that your children have drawn and use it on a
special cake for them. I teach cake decorating for Wilton and we use this method with
royal... Show more content on Helpwriting.net ...
The cake is easier and cleaner to work with chilled and the chocolate has to have an
hour or two to set. The finished cake had the heads of all my family on it as well as
my cat and the outline of our house. Everyone had a blast getting a piece that had
their head attached. This is a fun way to bring kids into he kitchen and to create a
one of a kind cake that will be special to the whole family. Don t worry about how
the finished product looks, even if everything breaks and you sprinkle the chocolate
over the top it was still fun had by the whole family and it is still yummy cake so it
is a win win :) Get your kids in the kitchen have fun and make messes but most
importantly make
The Effect of Racism on the Self-Esteem of African...
Throughout the past, scientists have attempted to explain the health disparity
between African Americans and Whites. With the completion of the human genome
project, it was shown that there is very little difference between different races on
the genetic level. However, African Americans are twice as likely to die from
cardiovascular disease as their European counterpart, the question that has arisen is
where do these differences stem from (Harell, Floyd, Daniels and Bell). Recently,
scientists have begun to believe that racismcould possibly explain these differences
(Belgrave Allison, 2010).
Racism has been an issue for African Americans since the early days of slavery.
Everywhere they go, they face a possibility of being ... Show more content on
Helpwriting.net ...
Participants
For this study, two hundred African Americanstudents will be surveyed. They will
be randomly sorted into three groups One quarter will watch a racist interaction
between an African American and a White person, One quarter will watch a neutral
interaction, and the last quarter will watch a positive interaction. The control group
will be the group who viewed the neutral interaction. These groups are valid because
the control group is not viewing any incidents of racism, which gives a basis to
measure the other groups. The incentive for this study is that the students will
receive some sort of academic repercussion. The students will give their informed
consent to participate in this study and they will be allowed to back out at any time.
All ethical guidelines will be followed.
Materials
Heart rate levels will be recorded when the participants view the interaction between
the African American and White person by using a hand grip heart monitor. Blood
pressure will also be recorded before the participants view the interaction and after.
Self esteem will be measured at the beginning of the experiment using the
Rosenberg s Self Esteem scale. Racism will be measured using the Perceptions of
racists discrimination self report and The Scale of Racial Socialization for
Adolescence (Fischer Shaw,
Analysis of Where the Wild Things Are Essay
Where the Wild Things Are, a children s book written by Maurice Sendak, is not
only directed to young children, but has an underlying message that is intended for
older generations to receive. This message, only used to enhance the meaning of
the story, describes the addiction for one to have power and be in control. As the
story goes on, the realization sets in that maybe the desire for power is not the best,
at all times. The use of oppression becomes evident in this story, through Max, the
main character, as he strives to control everything around him. Maurice Sendak uses
repetition and parallelism in the imagery and text of Where the Wild Things Are to
show Max s progression to assume power and eventually discard it. In the very...
Show more content on Helpwriting.net ...
As Max begins to lose control of his behavior and imagination, these white frames
become smaller and smaller. Once Max s imagination has taken him to Where the
Wild Things Are, the white borders are completely gone and Max s room has
made a full transformation. Max has finally left reality, in search of a land to rule
and call his own. As the story goes on, Max continues to exercise power through
his imagination. He has completely left the realm of reality in search of a place to
control. Once Max s room first changes, due to his imagination, his own personal
boat arrives to take him away. The rest of his room becomes a wild jungle, where
the wild things live. These large creatures, known as the wild things, inhabit Max s
room and soon become the perfect subjects for Max to take control of. First, Max
has little interaction with the wild things, but soon, he takes full control. Max yells
at the wild things, ordering them to do what he pleases. This shows that Max is
displacing the anger he feels at his mother for yelling at him, onto the wild things.
Max then begins the wild rumpus, an act in which all of the wild things and Max
partake in. All of the creatures and Max are simply playing around in an unmannered
form, causing trouble. This trouble continues due to the lack of adult guidance and
the abundance of free imagination. While the rumpus is taking place, again the
illustrations change to fit the scenes. Since Max has become the leader, and
My Reflection On Hmong History
Reflection 1: Hmong studies Over the years of growing up as a Hmong Female I
have always had a personal interest in learning more about my culture. After my
evaluation Hmong Studies Journal, Volume 9 by Jacques Lemoine, I can agree with
some of his studies, as a western Hmong I would never agree that the Kexiong, Hmu,
are Hmong. I disappointed to see that there are so many confusion about the hmong
history. In my opinions, I cannot understand why the Chinese historian can say that
the Kexiong and Hmu are Hmong. I understand that there is multiple ethnic group
are consider Miao, but that does not mean they are Hmong. There is no a language
barrier between Kexiong, Hmu and Hmong; because we all speak different
languages. I Believe there is
Asymmetric Threats Essay
Currently there are several definitions of asymmetric threats listed throughout the
internet as well as other literature. The definition that best sums up the meaning in
my view is leveraging unconventional tactics against a superior opponent with the
goal of disrupting the willingness to achieve the operational objectives. The most
common and current example of this would be the insurgency tactics used in Iraq and
Afghanistan. The United States must not assume those tactics and strategies will
only be used abroad. The same asymmetric threats our country s security initiative is
facing are the same challenges are seaports are facing. Some examples of the potential
asymmetric threats the United States seaport faces are nuclear weapons,... Show more
content on Helpwriting.net ...
The impact of a chemical environment would also lessen the dominance of a United
States military operation. The United States military is commonly known to operate
both deployment and re deployment operations at specific ports of embarkation and
debarkation; making targeting for a chemical attack fairly simple.
Like chemical weapons, biological weapons are easy to obtain, but the area covered
by such an attack is fairly small and limited. The most effective area to use a
chemical weapon on a seaport would be the operation center of that port due to the
limited damage it will cause to the infrastructure. The psychological effect of VX or
Sarin would devastate any port operation and to trace the origin of the agents would
prove to be very difficult.
The most common vulnerabilities to seaports exist due to the geographical location
and the amount of activity surrounding most seaports. Highways, railways, and
joining waterways create many security issues and make larger seaports terrorist
strategic targets. The sheer size of the sea requires numerous resources and assets
from agencies such as the United States Coast Guard. The task of monitoring and
securing seaports is an international challenge because the United States trade goods
with various countries. Security standards vary from country to country causing any
substandard port to become an
The Major Decision Between Majors
The Major Decision Between Majors There are many different paths that can be
taken after graduation. Some people go to college. Others join the military or even
go right to work. Even some choose to take a year off and travel. No matter what
our choices are, we have to make them soon. Senior year is almost halfway over and
we have to choose our paths. Whether it is between colleges or majorthe decision has
to be made. It s always been a goal of mine to go to college. I will be most successful
after I get an education. I don t have to choose between paths, I know I will be
attending schools. The main choiceI have is choosing between my dream and being
practical. I am choosing between majors, Tourism, leisure and event planning or...
Show more content on Helpwriting.net ...
This has been my dream since I was a little girl. I have always wanted to be a
professional chef or a pastry artist. The more and more I look at the facts of this
major, the more and more I realize it is not what I want. It is not the college
experience. It is too unpractical. The Culinary Arts program at the Institute of
Culinary Education, consists of 650 instructional hours. Students are in the
classroom for 440 hours and on their externships for 210 hours acquiring real world
experience in the culinary field ( Careers ICE Alumni ). This is nothing like a four
year degree at Bowling Green State University. Every class will teach students a
specific skill. Beginning with basic ingredient identification, the culinary arts chef
instructors will help train the student s senses, guiding them through all the tips
and tricks of cooking. Over the course of the program, I would learn from an
average of four different chef instructors, which exposes me to a wide range of
professionals with different areas of expertise ( Careers ICE Alumni ). After going
to this institute I would have everything I need to become a professional chef, but
this does not guarantee success right off the bat. Most chefs don t start out in their
dream jobs, they have to work towards their goal for years. I don t want to work in
low grade restaurants for years before I achieve a decent job.
This institute has a wide range of class schedules are designed to accommodate both
The s Alright, Because I Love The Way You Lie Essay
That s Alright, Because I Love the Way you Lie
Oh, cried Lizzie, Laura, Laura, / You should not peep at goblin men. / Lizzie cover d
up her eyes, / Cover d close lest they should look; / Laura rear d her glossy head,
/ And whisper d like the restless brook: / Look, Lizzie, look, Lizzie, / Down the glen
tramp little men. / One hauls a basket, / One bears a plate, / One lugs a golden dish
/ Of many pounds weight. / How fair the vine must grow / Whose grapes are so
luscious; / How warm the wind must blow / Through those fruit bushes. / No, said
Lizzie, No, no, no; / Their offers should not charm us, / Their evil gifts would harm
us. / She thrust a dimpled finger / In each ear, shut eyes and ran: / Curious Laura
chose to linger/ Wondering at each merchant man. / One had a cat s face, / One whisk
d a tail, / One tramp d at a rat s pace, / One crawl d like a snail, / One like a wombat
prowl d obtuse and furry, / One like a ratel tumbled hurry skurry. / She heard a voice
like voice of doves / Cooing all together: / They sounded kind and full of loves / In
the pleasant weather. Pg. 1652, Lns. 48 80, Christina Rossetti
In April 1859 the poem Goblin Market was produced and later published in 1862.
After publication, many argued between weather or not the poem was meant to be a
children s poem, but author Christina Rossetti later makes a statement that is clear in
that her poem was not, in fact, meant for children as it contains explicit imagery. In
her poem,
The Pros And Cons Of Child Labor
What is child labor? And how bad has it gotten over the years? According to the
author of the Opposing View Points on Child Labor It s known throughout the
years that child labor was a common thing. Child Labor is a problem of immense
and economic proportions in many developing regions of the world today (Hugh
D Hindman 233). In some places children working alongside their parents to
provide was usual. Children were put to work in factories and mines in the
Industrial Revolution. Kids young as six worked up to sixteen hours a day. Even
some where beat by the bosses if they didn t do anything right or were to fall asleep
on the job. They often work in horrible conditions, like operating dangerous
machinery or other dangerous tasks. In 1802, Britain s factory Act made it so
children nine to thirteen can work no more than eight hours per day. And the ages
fourteen and up can work to twelve hours per day.
A mission to ban child labor in 1904, but it didn t to get successful legislation passed.
A convention in 1937 called the International Labour Organization adopted the
minimum age convention. This requires each country to pursue a national policy
designed to ensure the effective abolition of child labor and to raise progressively the
minimum age for admission to employment or work to a level consistent with the
fullest physical and mental development of young persons. About around one
hundred fifty five countries have since ratified the convention and
Reflection Paper On Personality
Personality is a big part of who we are. Each personality is different. They all very
in their strengths and shortcomings. Whatever type of personality a person may
have, it is going to affect every aspect of their life. This is very true when it comes
to their chosen career path. Your place of employment is one of the only places as
an adult, that you can t control who you interact with. It is great to understand how
your personality can shape your career path, your leadership style, and how you
interact with co workers. A better understanding of your personality can help you
create a better future for yourself.
Step 1 ... Show more content on Helpwriting.net ...
In most other States being a hearing officer is a decent to very good job where a
person could expect to earn a decent to very good income. In Florida, the system is
set up so that it mass produces these hearings at a rate that generates money for the
State with little regard for the quality of the service and the individual needs of the
Petitioner. To put things into perspective; Florida makes up the highest percentage
of hearing officers, pays about 1/3 of what people in other states receive, uses a
computer program from the 1990 s, and does all its training via three 2 day long
power point presentations. Very little care is giving to individuals who are down
on their luck but the whole process can be done quite easily for someone that has
higher level of income. The process of holding these hearings and entering in or
removing suspensions is very complicated, repetitive and outdated. Because of the
nature of the work many people who have worked there for a long while become
very dissatisfied. To sum up my work situation; I work in an environment that has
little purpose, low pay, is biased against the poor, has a high rate of turnover, is
repetitive and outdated, doesn t pay very well, and produces a low quality product
in my opinion. INFJ s have a very difficult time with careers that involve minutia or
very detailed tasks(personalitypage). In my current job, I have the hardest time
entering in every code, and following every step
Boise Bridge Project Reflection Paper
As the Building a Boise Bridge project continues, I have really enjoyed getting to
know the teachers and students working on this project a little more! This project
takes place at Taft Elementary School, which is a public school in the Boise School
District. Unfortunately, with the session on Thursday the 5th being moved up to
Monday the 2nd, I was unable to attend that week. But I was able to attend the last
session, and enjoyed catching up with the students and teachers involved with this
project.
The teachers who I have interacted with the most are Kelly Kolpitcke, and Sarah
Wright. Megan Axtman is another teacher involved in the project, but I have not had
an opportunity to work with her yet. Kelley is a 5th grade teacher at Taft ... Show
more content on Helpwriting.net ...
The students watched this video, then discussed what they thought were the
important take aways. The main points the teachers seemed to want the students to
take away from that video is what causes earth quakes, what are the strongest type of
earthquake, and how do we measure earthquakes. The second video the class watched,
showed video footage of the aftermath of some earthquakes that have happened in
history. The video showed destruction of buildings, and how earthquakes can cause
tsunamis and the destruction that tsunamis also cause. The point of this video was to
show the students how important the engineering of building is, and got them to start
thinking about their own bridges and how they can withstand an earthquake. We did
not directly discuss bridges this week though, our focus was primarily on earthquakes.
When we broke up into our teams, my team was trying to answer two specific
questions; what are the effects of an earthquake? And can we build earthquake proof
buildings. I worked with two boys in the class, Kendall and Sean to help answer
these questions. To answer these questions each of the students had a laptop and used
Google Classroom to access links to websites the teachers provided to answer these
questions. We discussed what the effects of an earthquake are, this included
destruction of buildings, fatalities,
Examples Of Inside Out And Inside Again Essay
Inside and Back Again essay Refugees are everyday people who are forced to flee
their homes because they are afraid to stay in their home country. When they flee,
they may leave behind family members, friends, a home, a job, and special
possessions. In the nonfiction texts children of war by Arthur Brice, Refugee children
in Canada; Searching for Identity by Ana Marie and Alice Colak, and the novel
Inside out and Back Again by Thanhha Lai, the common experiences of refugees are
shown. The refugee experiencepresented in both nonfiction and historical texts
portray individuals whose lives are turned inside out by violent disruptions or
challenging life circumstances. The refugee experience is also characterized by the
long journey... Show more content on Helpwriting.net ...
This experienced by Amela, a young refugee in Children of War , I like it better
than being a refugee in Croatia. Here people don t judge you by your religion.
When I say that I m Muslim they don t react like, oh I don t want to be your friend
because you re muslim. Some people here don t even know where bosnia is, but
there really nice and try to help. Amela from Croatia is saying how people don t
judge her by religion, she s really enjoying time in america and people are being
really kind and welcoming in her new culture. In Refugee Children in Canada;
Searching for Identity Sanela and her family, other refugees are now experiencing
turning back again, This family was provided with extensive settlement support and
counselling. They were connected with a canadian host friendship family. As a result
of this important community connection, the family began to feel supported and
encouraged about their prospects for the future. Sanela has expressed a sense of relief
and has shown signs of optimism. Sanela and her family turned inside out but with
help from others they got the support and encouragement they needed to turn back
again. This shows that it s not easy turning back again but with help from others it
can happen. In Inside out and back again, Ha, a young refugee, is experiencing
making new friends in her new school, instead of
Evaluation Of A Project Manager Management
The report describes the tasks performed by me in accordance to the directives given
by the course COSC 684 300: Professional Internship in Summer 2015 semester. The
internship was scheduled from May 18, 2015 thru August 18, 2015. Mainly, three
task areas were selected and agreed upon in the agreement between me and the
company.
Activities and Experience: Preparing estimates by performing take offs for
windows and lighting provided a practical experience to the coursework in
estimation. Master schedule, daily, weekly and monthly forecasts for a project was
covered by scheduling and also the various processes that go into making the
schedule more efficient like crashing were observed on site as well as from the
perspective of a project manager. During the course of work, a proposal for
standardizing the processes like material management on site, preparing punch lists
and work force management were proposed by me which are implemented or in the
stage of implementation after review, this is intended to improve productivity and an
attempt to embrace lean principles in the organization. During the biding process, the
interactions with the bidding contractors and the negotiations we conducted was
application of negotiations in competitive environment. Processing the change orders,
preparing the scope of work, work schedule, contract agreement and schedule of
values would act as a perfect foundation for contracts and risk management. Company
operations were observed and
Reagan s Role During The Demise Of The Soviet Union
Reagan s Role in the Demise of the Soviet Union Entering into the 1980s, the
Soviet system was already in deep trouble. In order to match the US arms arsenal,
it had put itself in a position, whereby the Soviet economy was finding it difficult
whether to first put bread on the table of a common Russian or to match US in a tit
for tat response. Though Gorbachev s intentions were to strike a deal with the
United States in order to put a halt to the arms race, which was straining the Soviet
economy at the seams; however, Reagan kept the pressure of the SDI or the Star
Wars programme on the Russians. He also encouraged Gorbachev to introduce more
reforms, which resulted into Glasnost and Perestroika. Reagan s famous speech at the
... Show more content on Helpwriting.net ...
In my view, Gorbachev s trust on Reagan came to a point where he was ready to
take the leap of faith and that ensured a peaceful outcome of the cold war endgame.
This all shows that how powerful impact the Summits can have on the psyche of a
leader of a nation. By the time Reagan had gone, USSR unilaterally announced the
cut in its defence arsenal in 1989, the Warsaw pact countries were moving towards
democratization and finally in December 1991 saw the final enactment of the
dissolution of the Soviet Union.
Reykjavik Summit, October 1986: Reagan Gorbachev
(Gorbachev proposed phasing out nuclear weapons in return for US abandonment of
SDI) Although the Geneva summit was not a success, however it gave the
opportunity to both the leaders to size each other up. 1986 was not an easy year for
Michael Gorbachev. When Ronald Reagan proposed that the next two meetings
should be held in Washington and Moscow, Gorbachev forcefully demanded that a
substantial Arms Control agreement should be signed. However Reagan did not
want to give the impression that in order to have a meeting with Gorbachev, he had
given concessions to him. Reagan therefore, refused to commit on an arms control
agreement in the following meeting. However in January 1986, Gorbachev made an
offer to Ronald Reagan which he could not refuse. In January of that year, Gorbachev
Clinical Supervision Model
Supervisors provide effective formative and summative feedback, promote growth
and self assessment in the trainee, and they also have to be able to conduct their
own self assessment. These skills encourage the trainee in the process of
supervising. Clinical supervision is defined as: An intervention that is provided by a
senior member of a profession to a junior member or members of that profession.
This relationship is evaluative, extends over time and has simultaneous purposes of
enhancing the professional functioning of the junior member(s), monitoring the
quality of professional services offered to the clients she, he or they see(s) and
serving as a gatekeeper for those who are to enter the particular profession (Bernard
Goodyear,... Show more content on Helpwriting.net ...
Counselors have a responsibility to monitor their effectiveness, in order to do this
they need someone who is trained to assist them in understanding what is
effective. Counselors have to seek supervision when appropriate and in order to do
so a program needs to be in place that has supervisors readily available. The absence
of clinical supervision may lead to counselors in training to lack the necessary skills
to be a successful and productive counselor. Counselors need to develop a
comprehensive understanding of the setting, population, needs, contexts and tasks of
a counselor. As explained by Milne and Oliver (2000), Clinical supervision is central
to initial professional training and to continuing professional development. It is
necessary for counselors in training to refine their skills and get assistance in
applying theories to any issues they may encounter with their clients. In addition to
the everyday assistance necessary, a supervisor needs to present/model ethical
behavior and counseling practices. In any profession the need for improvement is
prominent and therefore any assistance and feedback given is appreciated and
necessary. Expectations are increasing and therefore supervision is expected.
Evidence shows that supervision results in school counselors increased effectiveness
and accountability, improved professional development, and improved job
performance, confidence, and comfort
Dinosaurs And Birds Essay
Dinosaurs and Birds
Are birds really dinosaurs or are they simply related? That is a question that has
gained new life in recent years due to the overwhelming facts the are pouring in
from newly found fossils and studies from fossils that have been found in the past.
Two groups have formed in the study of this question: those who believe birds are a
direct result of dinosaurs and those who feel dinosaurs and birds must have had a
common ancestor. Determining which view is correct is a matter of opinion based
on fact. The main problem involves the use of cladistics or phylogenetic systematics
to group organisms according to characteristics they share. When one looks at
dinosaur fossils, he or she may feel that certain ... Show more content on
Helpwriting.net ...
Also, support is gaining that Archaeopteryx was not in fact the first bird, but instead
a descendent of an earlier bird ancestor that had developed along a different pathway
and actually represents an evolutionary dead end.
Two opponents of the birds are dinosaurs theory are Alan Feduccia of the
University of North Carolina and Larry Martin of the University of Kansas. They
believe that birds evolved from some unknown reptile from a time before dinosaurs
came to be. One point they make is that flight must have begun from tree climbing
or an arboreal ancestor but that all the proposed dinosaurian ancestors were ground
dwellers or cursorial On the other side, supporters for the birds are dinosaurs theory
feel there is an unknown dinosaur bird that was arboreal, or simply that birds evolved
flight from the ground by chasing after insects.
In recent years other fossil finds have stirred the argument even more. One of these
is the fossil named Sinosauroptyrex found in China. It appears to be an important
link between birds and dinosaurs. Sinosauropteryx appears to be a feathered
dinosaur having a mane of feathers along its neck, back, and tail a feature until then
seen only in birds. Sinosauroptyrex appears before Archaeopteryx and gives a
substantial link between the theropods and birds. One opponent of this find is Martin
who feels the
The Issue Of Reproductive Rights
The topic of reproductive rights surrounding women in Texas has been a hot
buttoned issue since the closing of many reproductive centers across the state.
Recently damaging abortion restrictions were passed and therefor encroach on
women s reproductive rights even more by decreasing access to abortion care.
Texas 84th Legislature, both passed HB 3994 as a law and had it Governor Abbott
make it effective with his signature on July 8, or this year. This law complicates
access to abortionservices for mistreated and neglected minors and for those who do
not possess specific identification cards in Texas.
Specifically HB 3994 has four requirements of the bill that would explicitly hinder
Latina minors. The first provision it that the bill will make it harder for a minor to
demonstrate that she needs a judge to approve her for an abortion because the level
of evidence that the minor must acquire is much more encompassing. Secondly, it
revises the requirement that a judges rule must be made immediately, expanding the
decision time from two days to five and prolonging the process. The third provision
withdrawals the requirement that in the case the judge cannot make an immediate
rule, then the minor s case was automatically granted. This third provision along with
the extension of the ruling time, could lead to a number of rules not being made and
to the possibility of the minor s application being denied. Fourthly, the new bill brings
limits on who can have their appeals heard
Ethical Issues In District 9
District 9 is a movie about aliens that come to Earth; they settle in Johannesburg
till they are made to relocate to another area and troubles arise from there. The
movie was released in 2009 and the time period of the movie is the year 1982 and
2009. It was a period of time when South Africa was going through a lot of problems
and these problems are reflected in District 9. Racial discrimination, segregation,
xenophobia and others are real life issues and moral issues reflected in the film.
The most obvious issue reflected in the movie is xenophobia and the treatment of
these foreign refugees. In the movie, the alien spacecraft is stranded in Johannesburg
and the government takes care of the malnourish aliens onboard. In real life South
Africa, Zimbabweans, refugees seeking refuge flood the country. These refugees face
discrimination by the locals and they are treated like dirt. ... Show more content on
Helpwriting.net ...
Apartheid was a social and political policy by the white minority government.
Everyone was segregated by their racial groups, public facilities were exclusive to
each race and they all lived far apart from each other. The movie was inspired by
the apartheid regime in South Africa and is reflected in the movie. The aliens take
refuge in the slums and then these slums are walled up and this is the only proper
place for them to live in. The aliens live in separate areas from the humans, which
is parallel to the apartheid policies in real life. There are signs everywhere in
District Nine s Johannesburg which tells the aliens that the facilities in the city is
for human usage and they cannot loiter and aren t welcome in shops. This is all true
in real life South Africa. Black majority live in designated areas and public facilities
have signs on them stating who can use it. Benches, beaches and toilets have signs on
them that say blacks only showing that only black people can use
STARS FIU Personal Statement Analysis
List all your commitments, involvements, and organizations you will be involved
with on campus and/or in the community during the 2015 2016 academic year.
Student Poets Eloquently Articulating Knowledge (S.P.E.A.K.)
Global Community Engagement
Haitian Student Organization
Photography club
STARS FIU
Cru
Tell us the reasons why you are applying for these positions.
I am applying to these positions mainly because I want to get involved and help
organize the Relay for life at FIU next spring semester. In high school, I was an
ambassador of the Relay for life event at my school. It was organized by the Debate
Team, which I was part of. I had a wonderful experience. I would like to learn more
about Relay for life and the American Cancer Society, while I volunteer my time
and commit myself to this noble cause. I am truly passionate about raising money
for cancer research; my step mother is a cancer survivor so in her honor and all of the
cancer survivor around the world, I want to step forward and ... Show more content on
Helpwriting.net ...
What contributions can you make to the Relay for Life steering committee team?
I feel that Relay for Life e board members or chair need to be strong, motivated and
passionate about the cause. I feel that they need to commit to their responsibilities
while working collaboratively to put the event together. They should be
spontaneous, able to handle pressure and cope with stressful situation. I believe
that all of the previously cited qualifications are needed in order for a a Relay for
Life e board member or chair to work successfully.
In the Relay for Life steering committee team, I believe that I can bring creativity,
passion, new ideas and excitement about the projects that we plan along the way
for the Relay for Life event. I know that I can help the Relay for Life steering
committee team to plan a successful Relay for Life this year by putting a 100% effort
into
Information The Usage Pattern Of Open Accessing
Electronic...
USER SELECT AND TROUBLES IN OPEN ACCESSING E JOURNALS BY
THE STUDENTS OF PROFESSIONAL INSTITUTE IN TRIPURA STATE, INDIA
: A STUDY SOMA SARKAR Research Scholar, Department of Library and
Information Science, Madurai Kamaraj University, Madurai 625 021 Tamilnadu,
India Dr. K.CHINNASAMY Head, Department of Library and Information Science,
Madurai KamarajUniversity, Madurai, Tamilnadu, India. ABSTRACT E Journals
have great importance in libraries and amongst the library users. The present study
has been undertaken with an attempt to information the usage pattern of open
accessing electronic journals. The Profession students are mainly drawn from
different parts of colleges in Tripura State. For that purpose, survey method has been
adopted by the investigators, which comprises of administration of questionnaire,
observation of the participants, and interview of some of the participants for knowing
the opinion of the respondents in the respect of information of user accessing and
troubles for accessing in open accessing electronic journals for their academic and
research activities. The paper highlights the important survey findings in respect of
user selecting pattern and accessing troubles towards the electronic journals. Key
words: Electronic Journals, Open accessing e Journals, Selecting and Trouble Open
Access e Journals INTRODUCTION The web has influenced the developments of
new modes of scholarly communication including various discussion forum, websites
and
Copper Cycle Lab Report
The Copper Cycle
Alexes Montalvo Chem 1500 10 September 26, 2012
The Copper Cycle
Introduction:
The Copper Cycle is a popular experiment used to determine if an element, in this
instance, copper, reverts to its elemental form after a chain of reactions. This
experiment is very dangerous because of the reactions between the strong acids and
bases. In this experiment I performed a series of reactions starting with copper metal
and nitric acid to form copper (II) nitrate. Then I reacted copper and several other
solutions such as, sodium hydroxide, sulfuric acid, ammonium hydroxide, and
hydrochloric acid to form precipitates. In conclusion my percent recovery ... Show
more content on Helpwriting.net ...
If you see a deep blue color add more zinc powder until there is no change in color of
the solution in the test tube.
XI. Inside the fume hood, add a good amount of Hydrochloric Acid, HCl(aq), to the
solution in the 250 ml beaker to remove excess zinc. (accelerate reaction by heating
if the reaction appears slow)
XII. Take the 250 ml beaker to your lab bench. Set up a gravity filtration with a
plastic funnel, folded wet filter paper, and an Erlenmeyer flask. Pour the content in
the 250 ml beaker slowly through the filter paper. Wash the filter paper with
deionized water. Dispose of the filtrate in the proper labeled waste container.
XIII. Carefully remove the copper metal from the filter paper onto the watch glass.
(with a spatula) Place a 400 ml beaker on a hot plate contained with water. Carefully
place the watch glass before the water boils to dry the copper metal. (Use the tongs to
handle the hot watch glass)
XIV. Record your observations of the dried, cooled copper metal and weigh the
recovered copper.
Data Collection and Observations:
I started with elemental copper metal and then reactions occur step by step as follows:
|Experimental stage |Observations |
|1. Copper metal (penny) at the start |Tarnished, worn out, brownish, copper colored,
fine solid. |
|2.
Mutli-Agent Based Modeling
Multi Agent System/Agent Based Modeling
Multi agent systems are among the methods used for modeling and simulating
Natural Disaster emergencies. The terminology of Agent Based System tends to be
used more often in the sciences and Multi Agent System in engineering and
technology. The Agent Based System is gradually replacing the micro simulation
techniques and object oriented simulation. Agent Based System has ability to capture
different dynamic models which usually consist of simple entities or more complex
entities. We have proposed a specific agent based methodological framework
allowing, from modeling to simulation, the production of observables at different
levels of details related to a Natural Disaster organization.
A Multi Agent System can model the behavior of a set of entities. Agents have a
degree of autonomy and are immersed in an environment in which and with which
they interact. Modelers can use Multi Agent System to create computer
representations of dynamic events such as Natural Disaster emergency. Therefore, the
application of Multi Agent System in this area could help managers to experiment all
possible scenarios of a disaster and assist them in making decisions.
A multi agent based system is a powerful modeling technique for simulating
individual interactions in a dynamic system and is distinctive in its ability to simulate
situations with unpredictable behavior
Earlier researches have focused on modeling of the rescue during Natural Disasters,
but
Wang Lung s Filial Dishonesty In The Good Earth
The Good Earth is set in pre revolutionary rural China when women are inferior and
elders are most important. Those who treat their daughters as equals and do not
practice filial piety are considered outcasts. This is also a time when a man s life
revolves around the Earth. Food is grown from the Earth and clothes are sewn
from crops because nothing is made in a factory. Religion is based on Gods
watching over the land. People also believe that the Gods will curse a bad man and
reward a good one. If a man works the land diligently, remains honest, and practices
good morals, he may be rewarded with wealth, health, and tranquility. Some people,
however, do not work hard and live corrupt lives. As a result, they never experience
either wealth,... Show more content on Helpwriting.net ...
Wang Lung s uncle is very lazy and vicious. He is an unsuccessful farmer due to
his idleness. Sometimes he sells his crops when they are still in the ground because
reaping the harvests strip too much effort from the idle fool. Since he does not make
much money from his harvests, he blames it on bad luck and depends on Lung for
money. Since society operates in filial piety, Wang Lung has to give his uncle the
money. Lung s uncle also participates in gang violence and cannibalism. He is not
rewarded by the Gods. He did, however, have wealth and power by living in the
House of Hwang with Wang Lung but only because Lung has to obey him. Lung s
uncle never finds tranquility. He is never content with what he has. He is always
striving for more in vicious and idle ways which cause his unfulfilling life. Wang
Lung s cousin is also idle and vicious. He never learns to work and is very lusty.
When he lives with Wang Lung s family, he introduces Lung s eldest son to
prostitutes. He also flirts with his relatives and practices incest. He is not rewarded
by the Gods because he is so vicious. Instead, he never lives a fulfilling life. When
he grows up he abandons his wife and unborn
Rebirth in Sylvia Plath s Lady Lazarus, Fever 103,...
Rebirth in Lady Lazarus, Fever 103, Getting There, and Cut
The Ariel period poems of Sylvia Plath demonstrate her desire for rebirth, to escape
the body that was drummed into use by men and society. I will illustrate the different
types of rebirth with examples from the Ariel poems, including Lady Lazarus, Fever
103, Getting There, and Cut.
Lady Lazarus, the last of the October poems, presents Plath as the victim with her
aggression turned towards her male victimizer (33). Lady Lazarus arises from Herr
Doktor s ovens as a new being, her own incarnation, the victim taking on the powers
of the victimizers and drumming herself into uses that are her own (33). Linda
Bundtzen also sees the poem as an allegory ... Show more content on Helpwriting.net
...
During the multiple orgasms of Fever 103, the delirious woman sublimates a body
sick with desire into an acetylene virgin flame and thereby rids herself of any need
for men to complete herself sexually; Thus, Plath freed herself from male dependency
(Bundtzen 236).
Two Ariel poems Cut and Getting There do not exhibit a full rebirthbut rather exploit
the female body s victimization to mover towards new self perceptions (Bundtzen
247). In both poems the female body remains passive, acted upon by the mind s
transforming powers (Bundtzen 247). In Cut the amputation of the thumb is a
symbol of female castration; she became a dirty girl, unable to be a pure female
any longer. Plath understands her self amputation as an acting out of her self hatred
as a woman, she is deficient by virtue of her female wound (Bundtzen 247 248). The
speaker is cut while doing her duty and she unconsciously tries to stop it by cutting
off her finger.
In Getting There, the speaker is a Jew in a box car on her way to a concentration
camp. She identifies with all the wounded and dead: The tent of unending cries
(Plath 248). What gives the speaker this solemn sympathy with the casualties of war
is her female body. She knows these atrocities as a part of her very being, her genesis
(Bundtzen 249):
There is mud on my feet
Thick, red and slipping. It is Adam s side,
This earth I rise from, and
Essay on How do the later war poets differ in their...
How do the later war poets differ in their treatment of war from early war poets?
World War I was noticeable for the vast amounts of poetry that was produced from
many of the soldiers. The poets wrote vastly over the years 1914 1918 and they all
expressed many different opinions. It was a way of getting their views across to
other people. Some of the poems even made aware of the fact and the true horror
of the war. During the first half of World War I, the poems that were produced had
a very patriotic and glorious view to them. As the war progressed, the poems
became more bitter as the true extent of what was really going on, was unveiled.
Some of the poets we will be looking at include Wilfred Owen and Laurence Binyon.
For ... Show more content on Helpwriting.net ...
The Soldier has two versus to this poem. The first verse has eight lines and is
called an octet; the second verse has six lines and is called a sestet. Therefore, this
poem is a sonnet. It has a rhyme scheme of ABABCDCDEFGEFG. This gives the
poem a regular flow and a constant beat. This is much easier for the reader to
understand.
Fall In is another patriotic poem yet again and this is shown throughout the poem.
This poem has four versus and the rhyme scheme is
ABABCDCDEFEFGHGH and continues like this until the end of the poem.
This rhyme scheme has a regular and beat which makes the every second line of the
poem stand out to the reader.
The next poem we studied was Rendezvous written by Alan Seeger and it is quite a
dull poem about death. This poem also is a personification, like For the Fallen .
Only this time, the personification is of death. It, yet again, has a constant rhyme
scheme. Only this time, it is very effective. Because the poem is a dull poem, the
constant beat keeps the reader interested in the main topic of the poem.
You could say, if you wish, that most of the pre war poems we have studied are very
similar. They are patriotic and they promote the war.
They also don t tell you what the war is really like.
As the war progressed, the hideousness of the war became more apparent. With
poets like Sasson being produced, people could see the war for what it really was.
There were a number of poets that were
Roman Patronage Essay
In this essay, the topic to be discussed is that of patronage in the roman society.
Aspects of this to be looked at are the relationship between patron and client as well
as the roles and responsibilities of the two parties. Patronage in politics is another
topic to be acknowledged within this essay. Work on this later Patronage was a
mutual relationship between a man of wealth and influence, and a free client. This
was a relationship that law acknowledged in the early ages of the 5th century BC
and by 1st century BC it had become hereditary. However, patronage is said to have
originated in the dim past, possibly in the early monarchy, this idea is prompted by
this passage by Dionysius of Halicarnassus about the Roman founder: Romulus
entrusted... Show more content on Helpwriting.net ...
Therefore, the more clients a patron gathered, the better it was for their political
stance. And if a patron were able to gain a large portion of political clients, they
could retrieve power through both votes and by infiltrating every political group and
influencing all their loyal clients. Therefore, the practice in politics used by patrons
over their clients was of importance in the voting attended in the public assemblies
under the republic. Another aspect to be seen was that clients and patrons were not to
go against each other in court, perhaps due to another statement from Dionysius s
passage with It was unlawful and unholy for patricians and clients to bring suit
against one another, to testify against one another in court, or to vote against the
other. Thus emphasizing the laws in place when clients and patrons were associated
with politics and the court. An example of a patron could be Augustus, due to when
Augustus became First Citizen, he desired to be treated as a father or a patron by the
Roman world. In this, he brought about the patronage system. Through it, he
acquired many writer clients, for the writers, they gained a large market and large
financial support, and for Augustus it would promote his own personal
The Acidic Environment Around Us
The environment around us is certainly acidic. Even though people often think the
air around us is neutral, the atmosphere naturally contains acidic oxides of carbon,
nitrogen and sulfur that can harm our environment greatly. These oxides can be
produced naturally and industrially. Sulfur dioxide is produced when organic
matter decomposes and forms hydrogen sulphide which then oxidises to the oxide:
2H2S (g) + 3O2 (g) 2SO2 (g) + 2H2O. The natural sources of sulfur dioxide are in
volcanic gases, bushfires, sulfur rich geothermal hot springs releasing gases and
the decomposition of organic matter. The industrial sources of sulfur dioxide such
as in processing and burning of fossil fuels and extracting metals from sulfur rich
ores such as smelting of galena for lead: 2PbS (s) + 3O2 (g) 2PbO (s) + 2SO2
Nitric oxide is another oxide in the atmosphere that is formed when nitrogen and
oxygen react due to high temperatures of lightning: N2 (g) + O2 (g) 2NO (g). Other
sources of nitric oxide from industrial sources include the combustion of fossil fuels
both in cars and in power stations. The nitrogen in the air reacts with oxygen in the
hot engines. Another oxide that occurs in the atmosphere is nitrogen dioxide which is
produced after nitric oxide is produced by lightning and reacts with the oxygen in the
air: (2NO (g) + O2 (g) NO2 (g)), it is also released in large volumes in the atmosphere
by power stations. Nitrous oxide is an oxide that occurs on root nodules of legume
India Business Quiz
India Business Quiz : Questions with Answers 1. We have learned that if we
provide people with an occasion amp; an excuse to shop, they will come are the
Golden words of whom? Ans: Kishore Bayani (The Chairman of Future Group) 2.
What is the Title of Auto Biography of JRD TATA? Ans: Beyond the Last Blue
Mountain 3. What is the Title of Auto Biography of Krishna Kumar Birla? Ans:
Brushes with History 4. It happened in India is the Auto Biography of whom? Ans:
Kishore Bayani (The Chairman of Future Group) 5. The End of Ecconomic Man is
the famous book written by whom? Ans: Peter F Drucker 6. Imagining India recently
published book authored by? Ans: Nandan M Neelakeni 7.... Show more content on
Helpwriting.net ...
IMF stands for International Machinery Fund International Monetary Fund Indian
Machinery Fund Indian Monetary Fund3. SEC means.. Securities amp; Exchange
Commission Stock Exchange Commission Script Exchange Commission Special
Exchange Commission4. NSE stands for National Stock Exchange National Script
Exchange Network of Stock Exchange Non Stock Exchange5. NYSE is is acronym
for New York Stock Exchange New York Scripts Exchange New York Special
Exchange National York Securities Exchange6. NSDL stands for Network of
Securities Depository Limited Network of Stocks Directory Listing National Stock
Directory Limited National Securities Depository Limited7. ADR stands for All
Depositary Receipt Asian Depositary Receipt African Depositary Receipt American
Depositary Receipts8. In the context of Mutual Funds, SIP stands for.. Systematic
Investment Plan Scheduled Interest Plan Specific Insurance Plan Special Income
Plan9. In the context of Mutual Funds, ELSS means Endowment Linked Savings
Scheme Equity Linked Savings Scheme Established Line Savings Scheme
Entrepreneur Line Savings Scheme10. AMFI stands for Association of Mutual Funds
in India Arbitrated Mutual Funds India Arbitrated Monetary Funds India Associated
Mega Finance of India| 1. Financial Statements are reports on
Marketing Plan For A Marketing
Question #1: Develop a brief marketing plan for the event of your choice. Make sure
to identify the competitive advantages, target market(s), strategies, tactics, budgets,
and schedule and evaluation methodologies. Describe how you will increase your
marketing performance through creative and innovative tactics.
Answer: To promote the promotional event of Frizzy Drink, I will use certain
strategies and a particular way for the marketing plan. The marketing plan will cater
few things that will help the product in getting recognition. By adopting few of the
significant steps, the marketing plan would be very useful to promote the event
Pricing: The pricing of the product is the most important part in marketing plan to
promote the product in the event. Price of the product should be according to the
customers and the budget and costing of the product. Do not demand excessive
profit, it will lessen the demand of the product. The budgeting of the product is also
very important in pricing. Never use excessively expensive products that will
increase the product rate and customers feel reluctant in buying it due to high prices.
$3 to $4 would be very appropriate for the price of per unit.
Proper Marketing of the Product:
Proper marketing plan will ensure in making the product successful. Campaigns
would be carried out to promote the frizzy drinks on different forums including
public recreational areas, malls and offices. The event will cater a proper marketing
strategy in which the
College Dropout Boom Summary
For the Topic of the College Dropout Boom , David Leonhardt makes interesting
points on the topic of education and society s views on education. Some of the ideas
that he presented were debatable in my opinion, but most every point that he
addressed was correct. Growing up in a household where both of my parents
achieved a collegeeducation, I can personally say it extremely important in this day
and age to get a college degree, regardless of the immediate outcome. It will give you
an immense edge on the competition that you will face while applying for jobs in the
future.
One of the most engaging points that Leonhardt makes is the belief that someone s
economic class will greatly impact their decision on whether or not to go to college.
This ... Show more content on Helpwriting.net ...
There are scholarships and financial aid that you can apply for that can help you
throughout college, so there is no excuse behind saying that if you come from a
poor background that you can t get a college education. Another interesting point
that Leonhardt makes is that the American Dream is lost and the chances for
economic mobility have diminished over the past the few decades, which I agree.
I truly believe that the American Dream is still there; it s just a lot tougher than it
used to be to achieve your goals. My generation is very competitive when it comes
to school and getting into college. It s not as it once was back in the day when my
parents were growing up. Those bound for school in those years planned on going
to school nearby home and believed that a school in the radius of 300 miles away
from home is too far for them. They believed that applying to one or two schools
was enough, and also the acceptance rate was mostly very high. It used to be simple,
but not anymore. Now we have students that are coming from all around the world to
get an education in the United States with competitive grades and impressive high
school transcripts. With the increase of applicants to
The Devil And Tom Walker Imagery Analysis
Imagery is used to help create a more imaginative and well developed story. These
stories started to become more popular during the time of the Romantic and
Transcendentalist. Washington Irving was an extremely popular author during this
time, who was also an author that stretched and tested the limits of past authors
styles, as well as creating his own new style. Washington Irving s short storyThe
Devil and Tom Walkeris a retelling of a Germanic Faust legend. In the story Tom
Walker finds himself in a deep in the forest and comes face to face with the Devil.
The Devil tries to make an agreement with Tom, this agreement will make Tom
extremely rich. Tom ruminates over the choice he is given. His wife avidly wants
him to accept the proposal... Show more content on Helpwriting.net ...
Irving theme in this short story is that all action have consequences. In the story
Tom tries to trick the Devil by becoming more pious that others who have religious
their entire lives. However, it does not work, because one day the Devil comes
back for Tom holding a black horse, which neighed and stamped with impatience
(Irving 359). This small segment of imagery supports the theme, because the horse
is anxious and impatient as if it has waited a long time to be here and take Tom
away to what he deserves. The reader can imagine a horse that is rearing and ready
to go. It demonstrates that even if Tom protected himself for a little while the
Devil still came back to dispense the consequences for the deal he and Tom made
together. Tom worked as a usurer to gain a large fortune that he wanted, just so he
could flaunt it in an ostentatious manner. However he wanted to get this money
easily by bartering with the Devil to find an agreement that made him rich quickly.
He did get this money but he suffered consequences because of it, and when the
black horse swept him away all of his earthly treasure disappeared as well. All his
bonds and mortgages were reduced to cinders , his chest of gold and silver was
filled with chips and shavings , and where his two horse were two skeletons lay in
his stable (Irving 359). He was never able to enjoy the money he made, because of
the actions he took to gain it. On the other hand, Tom never did enjoy his money,
because of his stingy nature. Tom wanted all the money he could get his hands on,
but he never wanted to spend a dime. In addition with the added fear of the Devil
coming at any time Tom was always on edge and at peace. He made a deal with the
Devil and the Devil made him suffer the consequences of his actions. Old Scratch and
his black horse carried him off after Tom agonized under the unknown time the Devil
s return.
Little House Of The Big Woods By Laura Ingalls Wilder
Little House in the Big Woods by Laura Ingalls Wilder is a historical fiction book
because although much of what the author writes about are memories of her
childhood while growing up in the Big Woods of Wisconsin some of the stories
and characters were added or embellished. This story tells of Laura Ingalls and her
family and how life was for them in the Big Woods in the early 1870s. Survival
was not always easy for them but life was rewarding. For the Ingalls, survival meant
growing and harvesting their own crops, raising their own cows and chickens for
eggs, milk and butter, Pa hunted all summer and stored away enough food for the
harsh winters and almost everything the Ingalls wanted or needed they had to get and
make themselves. At... Show more content on Helpwriting.net ...
A woman named Sarah from Maine answers Jacob s ad and comes out to visit and
see if things would work between the two of them. The children, Anna and Caleb
are very excited to have a woman around again, but Sarah misses the ocean and the
beauty of Maine. Sarah and Jacob make a connection but the children worry their
dad and themselves are not enough to keep Sarah with them. Ultimately the
hardship and ruggedness of farm life don t matter to Sarah because she has grown
to love the Witting family and decides to marry Jacob and stay forever. Anne of
Green Gables by Lucy Maud Montgomery is a historical fiction book because it is
set in the 1880s on Prince Edward Island after Matthew and Marilla, an elderly
brother and sister adopt a boy to help around the farm but instead get Anne. Anne is
a spunky 11 year old who is not afraid to speak her mind. Matthew and Anne
connect and he decides he wants to keep her even though she is a girl. Anne doesn
t act proper like most young girls of her time but goes on adventures and gets in a
fair amount of mischief. She gains the attention of a boy named Gilbert but she is
not a fan of him after he calls her carrots because of her red hair. Eventually Anne
warms up to Gilbert and even starts to have feelings for him. Anne is very smart
and at 15 she decides she wants to be a teacher. She earns her teaching license in only
one year instead of usual two years and is offered a scholarship
Facts About The Movie Gladiator
The movie Gladiator is based on a fictional storyline that takes place during the time
of Ancient Rome. After having learned about Ancient Rome and the fashions of that
time, I can say that the film Gladiator had both accurate and inaccurate
representations of Ancient Roman fashion throughout. Some of the costumes, hair
and makeup shown in the movie were accurate, while others were not. Janty Yates
was the costume designer for Gladiator. There were certain aspects of the costumes in
this filmthat she did accurately according to the clothing worn in Ancient Rome. In
the movie, Maximus and the other slaves and prisoners of war were seen wearing
light blue and/or beige tunics. As mentioned in the video lecture, tunics were
extremely important in Ancient Romefor both men and women and would continue
to be in the years to come. Men wore them under their togas and women wore them
under their stola. Tunics on men and women were both shown in Gladiator
throughout the film. Toga trabea were seen early on in the film and were worn by
the emperor Caesar, and then by his son Commodus after he killed his father. The
toga trabea that they wore were purple which was historically correct since only the
Emperor and his sons were allowed to wear it. Their toga were also embroidered
intricately which showed their high status. However, I did come across a few
anachronisms regarding the color purple. In the scene where Maximus... Show more
content on Helpwriting.net ...
This was not covered in the textbook or in the video lecture, and was not commonly
seen in Ancient Rome. I also noticed that when Maximus was captured as a prisoner
of war many men around him were wearing turbans on their heads, which was also
not seen in Ancient Rome. However, hair and makeup in the film were accurate for
the most part. Most of the men in the film had the Caesar cut that was mentioned in
the video lecture, and the women had elaborate
Human Morphology
88. Although these molecules allow some radiations at visible wavelengths, where
most energy of sunlit is concentrated, to pass through, they absorb some of the
loneger wavelength, infrared emissions radiated from the Earth s surface, radiation
that would otherwise be transmitted back into space. 89. The role that anthropologists
ascribe to evolution is not of dictating details of human behaviors, but one of
imposing constrants ways of feeling, thinking and acting that come naturally from
architypal situations in any human cultures. 90. The role these anthropogists ascribe
to evolation is not of dictating the details of human behavior, but one of imposing
constrains ways of feeling, thinking and acting that come naturally in archetypal
situations in any cultures.... Show more content on Helpwriting.net ...
92. Which of the following most probably provides an analogy from human
morphology for the details verses constrains distinction made in passage in relation
to human behaviors? 93. A low number of algal cells in the present of a high
number of grazers susgested, but did not prove, that the grazers had removed most
of the algae. 94. A low number of algal cells in the present of a high number of
grazers suggested, but did not prove, that grazers had removed the most numbers of

More Related Content

Similar to Revision Essay

Of Mice And Men Introduction Essay
Of Mice And Men Introduction EssayOf Mice And Men Introduction Essay
Of Mice And Men Introduction EssayKaren Mosley
 
Define The American Dream Essay
Define The American Dream EssayDefine The American Dream Essay
Define The American Dream EssayReina Rosado
 
Mla Format Essay Outline. 009 Essay Outline Template Mla Format Thatsnotus
Mla Format Essay Outline. 009 Essay Outline Template Mla Format  ThatsnotusMla Format Essay Outline. 009 Essay Outline Template Mla Format  Thatsnotus
Mla Format Essay Outline. 009 Essay Outline Template Mla Format ThatsnotusHeidi Andrews
 
Mla Format Essay Outline.pdf
Mla Format Essay Outline.pdfMla Format Essay Outline.pdf
Mla Format Essay Outline.pdfMichelle Montoya
 
World’s Most Prominent Women Leaders in Business, 2024
World’s Most Prominent Women Leaders in Business, 2024World’s Most Prominent Women Leaders in Business, 2024
World’s Most Prominent Women Leaders in Business, 2024Worlds Leaders Magazine
 
Focusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdfFocusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdfarishmarketing21
 
Tips To Write An Essay Essa
Tips To Write An Essay EssaTips To Write An Essay Essa
Tips To Write An Essay EssaAndrew Molina
 
How To Write An Illustration Essay - Sample Assignment
How To Write An Illustration Essay - Sample AssignmentHow To Write An Illustration Essay - Sample Assignment
How To Write An Illustration Essay - Sample AssignmentTammy Moncrief
 
How To Insert Quotes Into An Essay Apa Format
How To Insert Quotes Into An Essay Apa FormatHow To Insert Quotes Into An Essay Apa Format
How To Insert Quotes Into An Essay Apa FormatDenise Snow
 
Essay On The Indian Cow. hindi essay on cow for class 3 - Brainly.in
Essay On The Indian Cow. hindi essay on cow for class 3 - Brainly.inEssay On The Indian Cow. hindi essay on cow for class 3 - Brainly.in
Essay On The Indian Cow. hindi essay on cow for class 3 - Brainly.inElizabeth Pardue
 
Reverend Hale Character Analysis Essay. Online assignment writing service.
Reverend Hale Character Analysis Essay. Online assignment writing service.Reverend Hale Character Analysis Essay. Online assignment writing service.
Reverend Hale Character Analysis Essay. Online assignment writing service.Kristin Thomas
 
Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...
Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...
Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...Bridget Zhao
 
Essay About Leaders. Good Leadership Essays. Learn How to Write
Essay About Leaders. Good Leadership Essays. Learn How to WriteEssay About Leaders. Good Leadership Essays. Learn How to Write
Essay About Leaders. Good Leadership Essays. Learn How to WriteTheresa Moreno
 
Graduate Entrance Essay
Graduate Entrance EssayGraduate Entrance Essay
Graduate Entrance EssayShannon Green
 
The Help By Tate Taylor Analysis - 946 Words Res
The Help By Tate Taylor Analysis - 946 Words ResThe Help By Tate Taylor Analysis - 946 Words Res
The Help By Tate Taylor Analysis - 946 Words ResErin Adams
 
Sample Scientific Essay
Sample Scientific EssaySample Scientific Essay
Sample Scientific EssayEmily Roberts
 
Research Essay On Human Trafficking. Online assignment writing service.
Research Essay On Human Trafficking. Online assignment writing service.Research Essay On Human Trafficking. Online assignment writing service.
Research Essay On Human Trafficking. Online assignment writing service.Amy Watkins
 
Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...
Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...
Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...Cristina Araujo
 
What Makes A Good Leader Essay
What Makes A Good Leader EssayWhat Makes A Good Leader Essay
What Makes A Good Leader EssayMelissa Nelson
 

Similar to Revision Essay (20)

Of Mice And Men Introduction Essay
Of Mice And Men Introduction EssayOf Mice And Men Introduction Essay
Of Mice And Men Introduction Essay
 
Define The American Dream Essay
Define The American Dream EssayDefine The American Dream Essay
Define The American Dream Essay
 
Mla Format Essay Outline. 009 Essay Outline Template Mla Format Thatsnotus
Mla Format Essay Outline. 009 Essay Outline Template Mla Format  ThatsnotusMla Format Essay Outline. 009 Essay Outline Template Mla Format  Thatsnotus
Mla Format Essay Outline. 009 Essay Outline Template Mla Format Thatsnotus
 
Mla Format Essay Outline.pdf
Mla Format Essay Outline.pdfMla Format Essay Outline.pdf
Mla Format Essay Outline.pdf
 
World’s Most Prominent Women Leaders in Business, 2024
World’s Most Prominent Women Leaders in Business, 2024World’s Most Prominent Women Leaders in Business, 2024
World’s Most Prominent Women Leaders in Business, 2024
 
Focusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdfFocusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdf
 
Tips To Write An Essay Essa
Tips To Write An Essay EssaTips To Write An Essay Essa
Tips To Write An Essay Essa
 
How To Write An Illustration Essay - Sample Assignment
How To Write An Illustration Essay - Sample AssignmentHow To Write An Illustration Essay - Sample Assignment
How To Write An Illustration Essay - Sample Assignment
 
How To Insert Quotes Into An Essay Apa Format
How To Insert Quotes Into An Essay Apa FormatHow To Insert Quotes Into An Essay Apa Format
How To Insert Quotes Into An Essay Apa Format
 
Essay On The Indian Cow. hindi essay on cow for class 3 - Brainly.in
Essay On The Indian Cow. hindi essay on cow for class 3 - Brainly.inEssay On The Indian Cow. hindi essay on cow for class 3 - Brainly.in
Essay On The Indian Cow. hindi essay on cow for class 3 - Brainly.in
 
Reverend Hale Character Analysis Essay. Online assignment writing service.
Reverend Hale Character Analysis Essay. Online assignment writing service.Reverend Hale Character Analysis Essay. Online assignment writing service.
Reverend Hale Character Analysis Essay. Online assignment writing service.
 
Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...
Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...
Cornell Mba Essays. 018 Essay Example Cornell Mba Essays Mit Sloan Tips Deadl...
 
Essay About Leaders. Good Leadership Essays. Learn How to Write
Essay About Leaders. Good Leadership Essays. Learn How to WriteEssay About Leaders. Good Leadership Essays. Learn How to Write
Essay About Leaders. Good Leadership Essays. Learn How to Write
 
Graduate Entrance Essay
Graduate Entrance EssayGraduate Entrance Essay
Graduate Entrance Essay
 
The Help By Tate Taylor Analysis - 946 Words Res
The Help By Tate Taylor Analysis - 946 Words ResThe Help By Tate Taylor Analysis - 946 Words Res
The Help By Tate Taylor Analysis - 946 Words Res
 
Sample Scientific Essay
Sample Scientific EssaySample Scientific Essay
Sample Scientific Essay
 
Research Essay On Human Trafficking. Online assignment writing service.
Research Essay On Human Trafficking. Online assignment writing service.Research Essay On Human Trafficking. Online assignment writing service.
Research Essay On Human Trafficking. Online assignment writing service.
 
Trickster Tales Essay
Trickster Tales EssayTrickster Tales Essay
Trickster Tales Essay
 
Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...
Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...
Is A Research Paper An Essay.pdfIs A Research Paper An Essay. research paper ...
 
What Makes A Good Leader Essay
What Makes A Good Leader EssayWhat Makes A Good Leader Essay
What Makes A Good Leader Essay
 

More from Stephanie Watson

Essay On Revolutionary War
Essay On Revolutionary WarEssay On Revolutionary War
Essay On Revolutionary WarStephanie Watson
 
Essay On If I Were Invisible
Essay On If I Were InvisibleEssay On If I Were Invisible
Essay On If I Were InvisibleStephanie Watson
 
Essays With Thesis Statements
Essays With Thesis StatementsEssays With Thesis Statements
Essays With Thesis StatementsStephanie Watson
 
Argumentative Essay On Animal Rights
Argumentative Essay On Animal RightsArgumentative Essay On Animal Rights
Argumentative Essay On Animal RightsStephanie Watson
 
Narrative Essay Samples For College
Narrative Essay Samples For CollegeNarrative Essay Samples For College
Narrative Essay Samples For CollegeStephanie Watson
 
Literary Analysis Essay A Rose For Emily
Literary Analysis Essay A Rose For EmilyLiterary Analysis Essay A Rose For Emily
Literary Analysis Essay A Rose For EmilyStephanie Watson
 
Sample College Admissions Essay.pdfSample College Admissions Essay
Sample College Admissions Essay.pdfSample College Admissions EssaySample College Admissions Essay.pdfSample College Admissions Essay
Sample College Admissions Essay.pdfSample College Admissions EssayStephanie Watson
 
Argument And Persuasion Essay Topics
Argument And Persuasion Essay TopicsArgument And Persuasion Essay Topics
Argument And Persuasion Essay TopicsStephanie Watson
 
Comparison And Contrast Essays Examples
Comparison And Contrast Essays ExamplesComparison And Contrast Essays Examples
Comparison And Contrast Essays ExamplesStephanie Watson
 
How To Write Narrative Essay
How To Write Narrative EssayHow To Write Narrative Essay
How To Write Narrative EssayStephanie Watson
 

More from Stephanie Watson (20)

Essay On Revolutionary War
Essay On Revolutionary WarEssay On Revolutionary War
Essay On Revolutionary War
 
Essay On If I Were Invisible
Essay On If I Were InvisibleEssay On If I Were Invisible
Essay On If I Were Invisible
 
Example Process Essay
Example Process EssayExample Process Essay
Example Process Essay
 
Essays With Thesis Statements
Essays With Thesis StatementsEssays With Thesis Statements
Essays With Thesis Statements
 
Argumentative Essay On Animal Rights
Argumentative Essay On Animal RightsArgumentative Essay On Animal Rights
Argumentative Essay On Animal Rights
 
Narrative Essay Samples For College
Narrative Essay Samples For CollegeNarrative Essay Samples For College
Narrative Essay Samples For College
 
Essay On Justin Bieber
Essay On Justin BieberEssay On Justin Bieber
Essay On Justin Bieber
 
Essays Uk
Essays UkEssays Uk
Essays Uk
 
Literary Analysis Essay A Rose For Emily
Literary Analysis Essay A Rose For EmilyLiterary Analysis Essay A Rose For Emily
Literary Analysis Essay A Rose For Emily
 
Popular Culture Essays
Popular Culture EssaysPopular Culture Essays
Popular Culture Essays
 
Essay On Sachin Tendulkar
Essay On Sachin TendulkarEssay On Sachin Tendulkar
Essay On Sachin Tendulkar
 
Noam Chomsky Essays
Noam Chomsky EssaysNoam Chomsky Essays
Noam Chomsky Essays
 
Stereotyping Essays
Stereotyping EssaysStereotyping Essays
Stereotyping Essays
 
Sample College Admissions Essay.pdfSample College Admissions Essay
Sample College Admissions Essay.pdfSample College Admissions EssaySample College Admissions Essay.pdfSample College Admissions Essay
Sample College Admissions Essay.pdfSample College Admissions Essay
 
Essays On Indian Economy
Essays On Indian EconomyEssays On Indian Economy
Essays On Indian Economy
 
Welfare Reform Essay
Welfare Reform EssayWelfare Reform Essay
Welfare Reform Essay
 
Never Cry Wolf Essay
Never Cry Wolf EssayNever Cry Wolf Essay
Never Cry Wolf Essay
 
Argument And Persuasion Essay Topics
Argument And Persuasion Essay TopicsArgument And Persuasion Essay Topics
Argument And Persuasion Essay Topics
 
Comparison And Contrast Essays Examples
Comparison And Contrast Essays ExamplesComparison And Contrast Essays Examples
Comparison And Contrast Essays Examples
 
How To Write Narrative Essay
How To Write Narrative EssayHow To Write Narrative Essay
How To Write Narrative Essay
 

Recently uploaded

Student login on Anyboli platform.helpin
Student login on Anyboli platform.helpinStudent login on Anyboli platform.helpin
Student login on Anyboli platform.helpinRaunakKeshri1
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingTechSoup
 
Measures of Dispersion and Variability: Range, QD, AD and SD
Measures of Dispersion and Variability: Range, QD, AD and SDMeasures of Dispersion and Variability: Range, QD, AD and SD
Measures of Dispersion and Variability: Range, QD, AD and SDThiyagu K
 
Organic Name Reactions for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions  for the students and aspirants of Chemistry12th.pptxOrganic Name Reactions  for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions for the students and aspirants of Chemistry12th.pptxVS Mahajan Coaching Centre
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfJayanti Pande
 
Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Disha Kariya
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)eniolaolutunde
 
Arihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdfArihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdfchloefrazer622
 
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...fonyou31
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityGeoBlogs
 
Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesFatimaKhan178732
 
Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17Celine George
 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13Steve Thomason
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...
BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...
BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...Sapna Thakur
 
BASLIQ CURRENT LOOKBOOK LOOKBOOK(1) (1).pdf
BASLIQ CURRENT LOOKBOOK  LOOKBOOK(1) (1).pdfBASLIQ CURRENT LOOKBOOK  LOOKBOOK(1) (1).pdf
BASLIQ CURRENT LOOKBOOK LOOKBOOK(1) (1).pdfSoniaTolstoy
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformChameera Dedduwage
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...EduSkills OECD
 

Recently uploaded (20)

Student login on Anyboli platform.helpin
Student login on Anyboli platform.helpinStudent login on Anyboli platform.helpin
Student login on Anyboli platform.helpin
 
Grant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy ConsultingGrant Readiness 101 TechSoup and Remy Consulting
Grant Readiness 101 TechSoup and Remy Consulting
 
Measures of Dispersion and Variability: Range, QD, AD and SD
Measures of Dispersion and Variability: Range, QD, AD and SDMeasures of Dispersion and Variability: Range, QD, AD and SD
Measures of Dispersion and Variability: Range, QD, AD and SD
 
Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"
Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"
Mattingly "AI & Prompt Design: Structured Data, Assistants, & RAG"
 
Organic Name Reactions for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions  for the students and aspirants of Chemistry12th.pptxOrganic Name Reactions  for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions for the students and aspirants of Chemistry12th.pptx
 
Web & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdfWeb & Social Media Analytics Previous Year Question Paper.pdf
Web & Social Media Analytics Previous Year Question Paper.pdf
 
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"Mattingly "AI & Prompt Design: The Basics of Prompt Design"
Mattingly "AI & Prompt Design: The Basics of Prompt Design"
 
Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..Sports & Fitness Value Added Course FY..
Sports & Fitness Value Added Course FY..
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)
 
Arihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdfArihant handbook biology for class 11 .pdf
Arihant handbook biology for class 11 .pdf
 
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
Ecosystem Interactions Class Discussion Presentation in Blue Green Lined Styl...
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activity
 
Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and Actinides
 
Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17Advanced Views - Calendar View in Odoo 17
Advanced Views - Calendar View in Odoo 17
 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 -  Danh muc Sach Giao Khoa 10 . pdf1029 -  Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...
BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...
BAG TECHNIQUE Bag technique-a tool making use of public health bag through wh...
 
BASLIQ CURRENT LOOKBOOK LOOKBOOK(1) (1).pdf
BASLIQ CURRENT LOOKBOOK  LOOKBOOK(1) (1).pdfBASLIQ CURRENT LOOKBOOK  LOOKBOOK(1) (1).pdf
BASLIQ CURRENT LOOKBOOK LOOKBOOK(1) (1).pdf
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy Reform
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
 

Revision Essay

  • 1. Revision Essay Crafting an essay on the topic of "Revision Essay" can prove to be a challenging endeavor. The complexity lies in the intricate balance one must maintain between self-reflection and constructive critique. When tasked with revising one's own work, a writer must navigate the fine line between acknowledging the strengths of the initial draft and recognizing areas that warrant improvement. It involves a critical examination of the clarity of ideas, the coherence of arguments, and the overall effectiveness of the communication. The difficulty intensifies as one grapples with the inherent bias that comes with being the author of the original piece. It requires a degree of detachment to objectively assess the work and identify weaknesses without succumbing to the temptation of overlooking flaws. This self- critical analysis demands a certain level of humility and openness to constructive feedback, often pushing the writer out of their comfort zone. Furthermore, the process of revising an essay necessitates a keen eye for detail. Sentence structure, grammar, punctuation, and overall writing style must be scrutinized meticulously. The challenge lies not only in recognizing these nuances but also in implementing changes effectively to enhance the overall quality of the composition. Moreover, the revision process can be mentally taxing. It requires the writer to revisit their ideas, confront potential shortcomings, and invest the time and effort needed for substantial improvement. This introspective journey demands patience, persistence, and a commitment to refining the work until it reaches its full potential. In conclusion, the difficulty of writing an essay on the topic of "Revision Essay" arises from the delicate balance between self-reflection and constructive critique, the challenge of objectivity when evaluating one's own work, the need for attention to detail, and the mental effort required to navigate the revision process. It is a task that demands not only writing prowess but also a willingness to embrace the challenges of self-improvement. If you find yourself grappling with such challenges or require assistance with various types of essays, consider exploring the services offered by HelpWriting.net. There, you can access a range of writing solutions tailored to your needs, ensuring that your academic or professional writing endeavors receive the support they deserve. Revision Essay Revision Essay
  • 2. Passing Essay The Root of Jealousy In Nella Larsen s Passing, Irene Redfield and Clare Kendry show us a great deal about race and sexuality in the 1920s. Both are extremely light skinned women of African American descent. However similar they appear to be, their views on race, a very controversial issue at the time, differ significantly. Clarechooses to use her physical appearance as an advantage in America s racist and sexist society, leaving behind everything that connects her to her African American identity. She presents herself as an object of sexual desire, flaunting herself to gain attention. Irene is practically the opposite, deciding that she wants to remain with the label of being black. She is subtle with her ... Show more content on Helpwriting.net ... When Irene finally realizes that this woman is Clare, someone who chooses to pass and hide all traces of her black heritage, Irene s opinion of her changes. She no longer wants to be involved with Clare in any way, and had no desire or intention of making the slightest effort about Tuesday. Nor any other day for that matter. She was through with Clare Kendry. (p. 31) Irene is appalled that someone can so easily throw away her background just for the sake of gaining privilege over another race. When Clare asks her if she had ever thought of passing, Irene replies, No. Why should I? You see, Clare, I ve everything I want. (p. 28) She is happy with what she has, not even having to give up anything to get there. Or at least that s what she convinces herself to believe. Irene is again hypocritical in her beliefs. Even when she opposes Clare s view of passing, she is still very interested in the idea. The truth was, she was curious. There were things she wanted to ask Clare Kendry. She wished to find out about this hazardous business of passing ... (p. 24) She even admitted that she held for her a fascination, strange and compelling. (p. 28) Irene doesn t seem to be able to decide if she accepts passing as reasonable. She forces herself to disagree with passing, allowing her to hate Clare for doing it. This shows us that sexuality and race are two matters that conflict with each other, at least in Irene s opinion. She uses race to
  • 3. Sundiata An Epic Of Old Mali Summary The sacred traditions, customs, and beliefs of ancient Mali is a story of epic proportions. To retrieve the great lineage of the First Kings of Mali and learn the history behind certain rituals told by an exquisite narrative that is perfectly woven together through different stories. The legend of Sundiata stresses the importance of understanding and respecting one s history. In D. T. Niane s Sundiata An Epic of Old Mali, the African history of Mali is presented through tribal customs, honor, and jealousy between brothers. Years and years ago in Africa, certain customs and traditions were set in place that governed different regions and tribes. People in Mali had a unique tradition bearer. In the first chapter of Niane s Sundiata An Epic of Old Mali, the reader is introduced to a griot who explains his role and his ancestor s knowledge on ancient Mali. The art of eloquence has no secrets for us; without us the names of kings would vanish into oblivion,... by the spoken word we bring to life the deeds and exploits of kings for younger generations. (Page 1) In a humble but guaranteed tone, the griot assures the reader that he is the keeper of all. His knowledge expands beyond what is now and covers what has been. Everything that has occurred in the kingdom of Mali is imperative for the griots to remember so the future kings would understand their heritage. They are the overseers of knowledge and without them there is no way the kings of Mali would have flourished.
  • 4. Makeup Is The Most Popular Eye Makeup Makeup has been around for over 10,000 years because women have always strived to make themselves perfect. Makeup is cosmetics such as lipstick or powder applied to the face and is used to enhance or alter the appearance.Over the years the use of makeup has been used for many things other than enhancing a womans natural beauty. Women wear makeup to look more appealing and boost their confidence rather than wearing it for a man. For instance eye makeup was onced used for getting rid of spirits and better sight according to makeup enhance. According to makeup enhance black and green was the most popular eye makeup colors. They decorated their eyes by applying dark green to the under lid and using kohl to outline the eyes, creating that alluring almond eye look ( Makeup Enhance). This is an example of makeup being used for other purposes rather than for what people think the only reason is which is to Look beautiful. When all women are already beautiful. Lipstick has been around for many decades. Lipstick is a waxy solid usually colored cosmetic in stick form for the lips (Merriam Webster). Egyptians had used two ingredients that are extremely deadly when combined together. Soon the lipstick had became known as the kiss of death . However they continued using the color to get red lips. Damien Gayle, author of Why red lips can make a woman look younger , found that the redness of lips decreases with aging. Red lips Over the years women has turned to
  • 5. My Strenght and Weaknesses as a Leader At twenty three, Carly Fiorina had dropped out of UCLA Law School with no plans about what she wanted to do with her future. However, almost twenty two years later, she became president and CEO of Hewlett Packard Company the first woman CEO of a Fortune 20 company. She was given a mandate by HP s board of directors to shake things up and was later named the Most Powerful Woman in Business by Fortune magazine. Prior to joining HP, Fiorina spent nearly twenty years at AT T and Lucent Technologies, where she held a number of senior leadership positions (Cara Carleton Fiorina. (2014). In 1999, Hewlett Packardhired Carly Fiorina, former senior executive of Lucent Technologies, as its Chief Executive Officer. Carly brought nearly... Show more content on Helpwriting.net ... She could not delegate or relate to her employees and without followers there can be no leader. The aspects of Traits theory that are relevant to Carly Fiorina can be summarized as two styles that were exhibited by her at HP: Achievement Oriented and Ambition. Fiorina s past achievements in business and her well known reputation for being ambitious were among the reasons she was hired by the Board in their desire to turn the company around. For example, she faced greater challenges than most CEOs in having to guide HP through a merger of computer maker Compaq, the acquisition culminating in 2002. It is identified that she was over ambitious in her leadership. A Leader wanting to grow the company is to be admired, but sometimes a company s culture and resources place practical limits on growth, especially in the short term. Fiorina was caught in the middle; she could not grow revenues and profits quickly enough to meet the Board s expectations. Concerning Path goal theory: In Fiorina s case 3 types can be identified: directive style, participative style, and achievement oriented style. As an example of the directive style, in early 1996, Fiorina stayed up all night with Lucent Comptroller, Jim Lusk, and other employees to make sure the prospectus for a stock offering was perfect. Concerning participative style, Fiorina imposed reorganization on HP but failed to adequately delegate
  • 6. Procedures For Support The Assessment Of Units And The... 16. ASSEMENT 16.1. Have the staff, resources and systems necessary to support the assessment of units and the award, accumulation and transfer of credits and, where necessary, the recording of exemptions. 16.2 Have arrangements in place that allow for recognition of prior learning (RPL) (where appropriate). 17.0 TERM AND TERMINATION 17.1 A Centre approval license granted under this agreement shall, subject to earlier termination in accordance with this agreement, continue for a minimum period of three years from the date upon which it is granted and shall continue thereafter until termination by either party giving to the other not less than six month notice in writing, such notice to expire on an anniversary of the date on which the Centre approval license was granted. 17.2 Approval of any approved course shall, subject to earlier termination in accordance with this agreement, continue for a minimum period of three years from the date upon which the approval is granted and shall continue thereafter until termination by either party giving to the other not less than six month notice in writing, such notice to expire on the anniversary of the date on which the approval was granted. 17.3 Assetв„ў may terminate the Centre approval license and/or the approval of any and all approval courses forthwith by notice in writing if the Centre is in breach of this agreement and shall have failed to remedy the breach (where the breach is capable of remedy)within 30 days of receipt of
  • 7. Evil Within the World, Depicted in J.R.R. Tolkien s The... Since the dawn of time, mankind has been plagued with the ever existing evils of the world. From the first murder by Cain to the opening of Pandora s Box, the concept of evil has permeated itself into the societies and cultures of the world throughout time. However, in a world of darkness we stand not alone. For wherever evil dwells, the forces of good are always likewise present to maintain the balance: right? In today s western world we often take this widely accepted belief for granted. After all, for every super villain there is always a hero, and for every damsel in distress there is always a happy ending, or at least that is what the media would have you believe. What I begin to see as I delve further in to the concept of good and ... Show more content on Helpwriting.net ... In a setting so contaminated by the evils of the world, how could an innocent little hobbit actually emerge as a character that has truly progressed for the better as most think? This brings us to the final impending question. Is there truly good in the world according to J.R.R. Tolkien in The Hobbit? This idea of good in the world has often been explored within countless pieces of literature and has marked itself as a truly meaningful concept to be evaluated. The main questions spurring from this concept, which are often explored, usually concern the presence of good and evil within a situation or setting. Building upon this I myself have chosen the concepts of good and evil for which I am to base my milieu. This milieu is to be expanded upon in my evaluation of The Hobbit and will be explored in terms of presence and sense of conformity to both the Boethian and Manichaean ideologies. I have chosen these specific ideologies to focus on for the reason that they represent both sides of an ongoing argument concerning the status of good in the world and therefore offer a fair balance to each other. The Boethian notion of good, in my opinion, asserts that the only working force within the world is that of good, and that what most perceive as evil is simply the absence of good. The Manichaean ideology (as previously mentioned) seems to be more of a modern interpretation of the working forces in the world. This ideology asserts that good and
  • 8. Virginia Beach s Offshore Wind Farm Solution Essay Virginia Beach, Virginia is making strides toward cleaner energy production, despite the threat of a coal fired power plant. Coal fired power plants, such as the Cypress Creek Power Station intended to be built in Surry County, Virginia, are environmentally harmful yet most cities are continuing to depend on them for a reliable and steady output of energy. This local environmental issue is a dilemma that many cities throughout the world are also experiencing. My study demonstrates how cities faced with these predicaments can find practical solutions for providing energy while being environmentally friendly. Scientific research along with the analysis of two scholarly articles explain the threats of coal fired power plants on humans health and the environment as well as the advantages and disadvantages of practical solutions. Based upon proven facts and research, I have provided my opinion that Virginia Beach s offshore wind farm solution is a suitable choice for that specific geographic region. What is not a suitable solution is the natural gas fueled power plant that is currently in the process of being constructed. In conclusion, this study demonstrates that there is no one size fits all solution to providing energy. Air Pollution in Virginia Beach; an Environmental Issue An environmental issue affecting the city of Virginia Beach, VA is the production of a coal fired power plant. In 2008, the local power company, Old Dominion Electric Cooperative (ODEC), started
  • 9. The Effect Of Acid Concentrations Increases Permeability... Change in pH concentrations increases permeability of beetroot (‎Beta vulgaris) cell membranes indicated through color intensity using the spectrophotometer Joshua Elekwa Introduction to cell Biology, Fall 2014 Mount Royal University ABSTRACT The cell membrane (Plasma membrane) functions to provide cell support, cell stability and control entry and exit of materials from the cell. This study was conducted to test the effects of environmental conditions such as the on beet root cell membrane (Beta vulgaris). Five trials using varied pH concentrations were tested and absorbance rates were monitored. The experimental results showed that the protein function decreased sequentially when the pH decreased. This allowed the betacyanin dye to leak out which created the color that was needed to determine the intensity and therefore the effect of the circumstances. This supported the hypothesis that the more acidic or basic the environmental condition around the beet cell, the more permeable the, membrane indicated by color intensity. Pigment leakage in the solution was analyzed by using a spectrophotometer. INTRODUCTION Plant cells have selectively permeable membrane that allows selective substances to penetrate into the cell. Cell membranes are consisting of lipid layer that are made up of phospholipids. (Essays, UK.2013). These phospholipids are amphipathic in nature, which have phospholipids head and tail respectively. Phospholipids heads are hydrophilic and tails
  • 10. Timing Of Events In Romeo And Juliet Essay Often in life, tragedies that occur have a lot to do with the bad timing of events. In William Shakespeare s play The Tragedy of Romeo and Juliet, two teenagers who live in the beautiful city of Verona, Italy fall madly in love at first sight. The problem with this is that their families, the Montagues and the Capulets, have been feuding for centuries. After a secret marriage, the two lovers are separated because of the actions of their families. The play tragically ends with the married couple committing suicide because of imperfect timing and confusion. Throughout this play, timing continuously plays a major role in all of the characters actions, eventually leading to tragedy. In the beginning of this play, drama and conflict are caused by flaws in timing of events.... Show more content on Helpwriting.net ... After Juliet and Friar Lawrence make their plan to fake Juliet s death, she tells her father she will agree to marry Paris. Ecstatic with her agreement, her father responds, Send for the county go tell him of this. I ll have this knot knit up tomorrow morning ( 4.2. 23 24). Capulet has just changed the date of the wedding. This leaves a very short amount of time to inform Romeo on Friar and Juliet s plan. Also, in Act 5 Juliet has already taken the sleeping potion. Everyone thinks she is dead including Romeo. Romeo arrives at Juliet s tomb, then after seeing her, drinks the poison to kill himself. When Juliet awakens, Friar Lawrence is there and she discovers Romeo s dead body. Juliet grabs a dagger and says, Yea, noise? Then I ll be brief. O happy dagger! This is thy sheath; there rust, and let me die (5.3. 169 170). This reveals that timing has just caused these two deaths. If Romeo would have known about the plan, if Friar would have arrived to the tomb earlier, or if Juliet would have awakened the two would still be alive. Two star crossed lovers committed suicide because of terrible timing of
  • 11. Essay about Hook Up Culture College and universities have made great strides over the years. The campuses have grown, and the resources have improved tremendously. However, it is questionable if that social scene on these campuses has changed for the better over the years. Work hard, party hard has become the motto of college students to live by. Students spend the week focused on their academics, striving to grow as intellects. However, the weekend becomes the time when students look to go out and socialize at the various parties. And this is exactly what the weekend is for. With growing causal party scenes, college students have been more inclined to have a casual relationship with the opposite sex. Traditional dating on college campuses is rarely seen anymore ... Show more content on Helpwriting.net ... Boston College freshmen, Caroline Gray says, I think college kids are under a false conception that they have to hook up with as many people as they can to have a good time, when I believe that we can get more satisfaction out of caring and being cared for and by one person. So, what happens when someone desires something more? The majority of the time the person who is left longing for more than just a casual hookup is the female. Women, by nature, are more likely to become more emotionally attached, especially when it comes to sexual activities. However, most of the time, girls will be willing to play along with the game of hooking up. Perhaps, in hopes, that it will someday lead to something more. But, if and when it doesn t, they can be left emotionally distraught. Girls will become attached to the person they are with and grow to have a sincere care for them. However, when it comes to picking a mate, boys are not as particular about the girl. A study, Age and gender differences in mate selection criteria for various involvement levels found that men should be equally as selective as women with respect to long term mates, but less selective than woman with respect to short term mates criteria (Kenrick). Boys are less likely to think about all aspects of girl when planning on hooking up with her, unlike girls. They are not as particular because they are just looking for
  • 12. Chocolate Art Research Paper Chocolate art!! Yep this week we are combining two of my favorite things chocolate and art. Before I explain the process to this I have to admit working with chocolate is not easy. I used chocolate chips if you recreate this you may want to use any melts that you can find at the craft store. Candy melts are a lot less temperamental than chocolate and you will have a better finished product than I did. I was trolling through Pinterest and I found this I how much fun it would be to recreate this cake in honor of my family on valentines day. You could also use this same method to recreate some pictures that your children have drawn and use it on a special cake for them. I teach cake decorating for Wilton and we use this method with royal... Show more content on Helpwriting.net ... The cake is easier and cleaner to work with chilled and the chocolate has to have an hour or two to set. The finished cake had the heads of all my family on it as well as my cat and the outline of our house. Everyone had a blast getting a piece that had their head attached. This is a fun way to bring kids into he kitchen and to create a one of a kind cake that will be special to the whole family. Don t worry about how the finished product looks, even if everything breaks and you sprinkle the chocolate over the top it was still fun had by the whole family and it is still yummy cake so it is a win win :) Get your kids in the kitchen have fun and make messes but most importantly make
  • 13. The Effect of Racism on the Self-Esteem of African... Throughout the past, scientists have attempted to explain the health disparity between African Americans and Whites. With the completion of the human genome project, it was shown that there is very little difference between different races on the genetic level. However, African Americans are twice as likely to die from cardiovascular disease as their European counterpart, the question that has arisen is where do these differences stem from (Harell, Floyd, Daniels and Bell). Recently, scientists have begun to believe that racismcould possibly explain these differences (Belgrave Allison, 2010). Racism has been an issue for African Americans since the early days of slavery. Everywhere they go, they face a possibility of being ... Show more content on Helpwriting.net ... Participants For this study, two hundred African Americanstudents will be surveyed. They will be randomly sorted into three groups One quarter will watch a racist interaction between an African American and a White person, One quarter will watch a neutral interaction, and the last quarter will watch a positive interaction. The control group will be the group who viewed the neutral interaction. These groups are valid because the control group is not viewing any incidents of racism, which gives a basis to measure the other groups. The incentive for this study is that the students will receive some sort of academic repercussion. The students will give their informed consent to participate in this study and they will be allowed to back out at any time. All ethical guidelines will be followed. Materials Heart rate levels will be recorded when the participants view the interaction between the African American and White person by using a hand grip heart monitor. Blood pressure will also be recorded before the participants view the interaction and after. Self esteem will be measured at the beginning of the experiment using the Rosenberg s Self Esteem scale. Racism will be measured using the Perceptions of racists discrimination self report and The Scale of Racial Socialization for Adolescence (Fischer Shaw,
  • 14. Analysis of Where the Wild Things Are Essay Where the Wild Things Are, a children s book written by Maurice Sendak, is not only directed to young children, but has an underlying message that is intended for older generations to receive. This message, only used to enhance the meaning of the story, describes the addiction for one to have power and be in control. As the story goes on, the realization sets in that maybe the desire for power is not the best, at all times. The use of oppression becomes evident in this story, through Max, the main character, as he strives to control everything around him. Maurice Sendak uses repetition and parallelism in the imagery and text of Where the Wild Things Are to show Max s progression to assume power and eventually discard it. In the very... Show more content on Helpwriting.net ... As Max begins to lose control of his behavior and imagination, these white frames become smaller and smaller. Once Max s imagination has taken him to Where the Wild Things Are, the white borders are completely gone and Max s room has made a full transformation. Max has finally left reality, in search of a land to rule and call his own. As the story goes on, Max continues to exercise power through his imagination. He has completely left the realm of reality in search of a place to control. Once Max s room first changes, due to his imagination, his own personal boat arrives to take him away. The rest of his room becomes a wild jungle, where the wild things live. These large creatures, known as the wild things, inhabit Max s room and soon become the perfect subjects for Max to take control of. First, Max has little interaction with the wild things, but soon, he takes full control. Max yells at the wild things, ordering them to do what he pleases. This shows that Max is displacing the anger he feels at his mother for yelling at him, onto the wild things. Max then begins the wild rumpus, an act in which all of the wild things and Max partake in. All of the creatures and Max are simply playing around in an unmannered form, causing trouble. This trouble continues due to the lack of adult guidance and the abundance of free imagination. While the rumpus is taking place, again the illustrations change to fit the scenes. Since Max has become the leader, and
  • 15. My Reflection On Hmong History Reflection 1: Hmong studies Over the years of growing up as a Hmong Female I have always had a personal interest in learning more about my culture. After my evaluation Hmong Studies Journal, Volume 9 by Jacques Lemoine, I can agree with some of his studies, as a western Hmong I would never agree that the Kexiong, Hmu, are Hmong. I disappointed to see that there are so many confusion about the hmong history. In my opinions, I cannot understand why the Chinese historian can say that the Kexiong and Hmu are Hmong. I understand that there is multiple ethnic group are consider Miao, but that does not mean they are Hmong. There is no a language barrier between Kexiong, Hmu and Hmong; because we all speak different languages. I Believe there is
  • 16. Asymmetric Threats Essay Currently there are several definitions of asymmetric threats listed throughout the internet as well as other literature. The definition that best sums up the meaning in my view is leveraging unconventional tactics against a superior opponent with the goal of disrupting the willingness to achieve the operational objectives. The most common and current example of this would be the insurgency tactics used in Iraq and Afghanistan. The United States must not assume those tactics and strategies will only be used abroad. The same asymmetric threats our country s security initiative is facing are the same challenges are seaports are facing. Some examples of the potential asymmetric threats the United States seaport faces are nuclear weapons,... Show more content on Helpwriting.net ... The impact of a chemical environment would also lessen the dominance of a United States military operation. The United States military is commonly known to operate both deployment and re deployment operations at specific ports of embarkation and debarkation; making targeting for a chemical attack fairly simple. Like chemical weapons, biological weapons are easy to obtain, but the area covered by such an attack is fairly small and limited. The most effective area to use a chemical weapon on a seaport would be the operation center of that port due to the limited damage it will cause to the infrastructure. The psychological effect of VX or Sarin would devastate any port operation and to trace the origin of the agents would prove to be very difficult. The most common vulnerabilities to seaports exist due to the geographical location and the amount of activity surrounding most seaports. Highways, railways, and joining waterways create many security issues and make larger seaports terrorist strategic targets. The sheer size of the sea requires numerous resources and assets from agencies such as the United States Coast Guard. The task of monitoring and securing seaports is an international challenge because the United States trade goods with various countries. Security standards vary from country to country causing any substandard port to become an
  • 17. The Major Decision Between Majors The Major Decision Between Majors There are many different paths that can be taken after graduation. Some people go to college. Others join the military or even go right to work. Even some choose to take a year off and travel. No matter what our choices are, we have to make them soon. Senior year is almost halfway over and we have to choose our paths. Whether it is between colleges or majorthe decision has to be made. It s always been a goal of mine to go to college. I will be most successful after I get an education. I don t have to choose between paths, I know I will be attending schools. The main choiceI have is choosing between my dream and being practical. I am choosing between majors, Tourism, leisure and event planning or... Show more content on Helpwriting.net ... This has been my dream since I was a little girl. I have always wanted to be a professional chef or a pastry artist. The more and more I look at the facts of this major, the more and more I realize it is not what I want. It is not the college experience. It is too unpractical. The Culinary Arts program at the Institute of Culinary Education, consists of 650 instructional hours. Students are in the classroom for 440 hours and on their externships for 210 hours acquiring real world experience in the culinary field ( Careers ICE Alumni ). This is nothing like a four year degree at Bowling Green State University. Every class will teach students a specific skill. Beginning with basic ingredient identification, the culinary arts chef instructors will help train the student s senses, guiding them through all the tips and tricks of cooking. Over the course of the program, I would learn from an average of four different chef instructors, which exposes me to a wide range of professionals with different areas of expertise ( Careers ICE Alumni ). After going to this institute I would have everything I need to become a professional chef, but this does not guarantee success right off the bat. Most chefs don t start out in their dream jobs, they have to work towards their goal for years. I don t want to work in low grade restaurants for years before I achieve a decent job. This institute has a wide range of class schedules are designed to accommodate both
  • 18. The s Alright, Because I Love The Way You Lie Essay That s Alright, Because I Love the Way you Lie Oh, cried Lizzie, Laura, Laura, / You should not peep at goblin men. / Lizzie cover d up her eyes, / Cover d close lest they should look; / Laura rear d her glossy head, / And whisper d like the restless brook: / Look, Lizzie, look, Lizzie, / Down the glen tramp little men. / One hauls a basket, / One bears a plate, / One lugs a golden dish / Of many pounds weight. / How fair the vine must grow / Whose grapes are so luscious; / How warm the wind must blow / Through those fruit bushes. / No, said Lizzie, No, no, no; / Their offers should not charm us, / Their evil gifts would harm us. / She thrust a dimpled finger / In each ear, shut eyes and ran: / Curious Laura chose to linger/ Wondering at each merchant man. / One had a cat s face, / One whisk d a tail, / One tramp d at a rat s pace, / One crawl d like a snail, / One like a wombat prowl d obtuse and furry, / One like a ratel tumbled hurry skurry. / She heard a voice like voice of doves / Cooing all together: / They sounded kind and full of loves / In the pleasant weather. Pg. 1652, Lns. 48 80, Christina Rossetti In April 1859 the poem Goblin Market was produced and later published in 1862. After publication, many argued between weather or not the poem was meant to be a children s poem, but author Christina Rossetti later makes a statement that is clear in that her poem was not, in fact, meant for children as it contains explicit imagery. In her poem,
  • 19. The Pros And Cons Of Child Labor What is child labor? And how bad has it gotten over the years? According to the author of the Opposing View Points on Child Labor It s known throughout the years that child labor was a common thing. Child Labor is a problem of immense and economic proportions in many developing regions of the world today (Hugh D Hindman 233). In some places children working alongside their parents to provide was usual. Children were put to work in factories and mines in the Industrial Revolution. Kids young as six worked up to sixteen hours a day. Even some where beat by the bosses if they didn t do anything right or were to fall asleep on the job. They often work in horrible conditions, like operating dangerous machinery or other dangerous tasks. In 1802, Britain s factory Act made it so children nine to thirteen can work no more than eight hours per day. And the ages fourteen and up can work to twelve hours per day. A mission to ban child labor in 1904, but it didn t to get successful legislation passed. A convention in 1937 called the International Labour Organization adopted the minimum age convention. This requires each country to pursue a national policy designed to ensure the effective abolition of child labor and to raise progressively the minimum age for admission to employment or work to a level consistent with the fullest physical and mental development of young persons. About around one hundred fifty five countries have since ratified the convention and
  • 20. Reflection Paper On Personality Personality is a big part of who we are. Each personality is different. They all very in their strengths and shortcomings. Whatever type of personality a person may have, it is going to affect every aspect of their life. This is very true when it comes to their chosen career path. Your place of employment is one of the only places as an adult, that you can t control who you interact with. It is great to understand how your personality can shape your career path, your leadership style, and how you interact with co workers. A better understanding of your personality can help you create a better future for yourself. Step 1 ... Show more content on Helpwriting.net ... In most other States being a hearing officer is a decent to very good job where a person could expect to earn a decent to very good income. In Florida, the system is set up so that it mass produces these hearings at a rate that generates money for the State with little regard for the quality of the service and the individual needs of the Petitioner. To put things into perspective; Florida makes up the highest percentage of hearing officers, pays about 1/3 of what people in other states receive, uses a computer program from the 1990 s, and does all its training via three 2 day long power point presentations. Very little care is giving to individuals who are down on their luck but the whole process can be done quite easily for someone that has higher level of income. The process of holding these hearings and entering in or removing suspensions is very complicated, repetitive and outdated. Because of the nature of the work many people who have worked there for a long while become very dissatisfied. To sum up my work situation; I work in an environment that has little purpose, low pay, is biased against the poor, has a high rate of turnover, is repetitive and outdated, doesn t pay very well, and produces a low quality product in my opinion. INFJ s have a very difficult time with careers that involve minutia or very detailed tasks(personalitypage). In my current job, I have the hardest time entering in every code, and following every step
  • 21. Boise Bridge Project Reflection Paper As the Building a Boise Bridge project continues, I have really enjoyed getting to know the teachers and students working on this project a little more! This project takes place at Taft Elementary School, which is a public school in the Boise School District. Unfortunately, with the session on Thursday the 5th being moved up to Monday the 2nd, I was unable to attend that week. But I was able to attend the last session, and enjoyed catching up with the students and teachers involved with this project. The teachers who I have interacted with the most are Kelly Kolpitcke, and Sarah Wright. Megan Axtman is another teacher involved in the project, but I have not had an opportunity to work with her yet. Kelley is a 5th grade teacher at Taft ... Show more content on Helpwriting.net ... The students watched this video, then discussed what they thought were the important take aways. The main points the teachers seemed to want the students to take away from that video is what causes earth quakes, what are the strongest type of earthquake, and how do we measure earthquakes. The second video the class watched, showed video footage of the aftermath of some earthquakes that have happened in history. The video showed destruction of buildings, and how earthquakes can cause tsunamis and the destruction that tsunamis also cause. The point of this video was to show the students how important the engineering of building is, and got them to start thinking about their own bridges and how they can withstand an earthquake. We did not directly discuss bridges this week though, our focus was primarily on earthquakes. When we broke up into our teams, my team was trying to answer two specific questions; what are the effects of an earthquake? And can we build earthquake proof buildings. I worked with two boys in the class, Kendall and Sean to help answer these questions. To answer these questions each of the students had a laptop and used Google Classroom to access links to websites the teachers provided to answer these questions. We discussed what the effects of an earthquake are, this included destruction of buildings, fatalities,
  • 22. Examples Of Inside Out And Inside Again Essay Inside and Back Again essay Refugees are everyday people who are forced to flee their homes because they are afraid to stay in their home country. When they flee, they may leave behind family members, friends, a home, a job, and special possessions. In the nonfiction texts children of war by Arthur Brice, Refugee children in Canada; Searching for Identity by Ana Marie and Alice Colak, and the novel Inside out and Back Again by Thanhha Lai, the common experiences of refugees are shown. The refugee experiencepresented in both nonfiction and historical texts portray individuals whose lives are turned inside out by violent disruptions or challenging life circumstances. The refugee experience is also characterized by the long journey... Show more content on Helpwriting.net ... This experienced by Amela, a young refugee in Children of War , I like it better than being a refugee in Croatia. Here people don t judge you by your religion. When I say that I m Muslim they don t react like, oh I don t want to be your friend because you re muslim. Some people here don t even know where bosnia is, but there really nice and try to help. Amela from Croatia is saying how people don t judge her by religion, she s really enjoying time in america and people are being really kind and welcoming in her new culture. In Refugee Children in Canada; Searching for Identity Sanela and her family, other refugees are now experiencing turning back again, This family was provided with extensive settlement support and counselling. They were connected with a canadian host friendship family. As a result of this important community connection, the family began to feel supported and encouraged about their prospects for the future. Sanela has expressed a sense of relief and has shown signs of optimism. Sanela and her family turned inside out but with help from others they got the support and encouragement they needed to turn back again. This shows that it s not easy turning back again but with help from others it can happen. In Inside out and back again, Ha, a young refugee, is experiencing making new friends in her new school, instead of
  • 23. Evaluation Of A Project Manager Management The report describes the tasks performed by me in accordance to the directives given by the course COSC 684 300: Professional Internship in Summer 2015 semester. The internship was scheduled from May 18, 2015 thru August 18, 2015. Mainly, three task areas were selected and agreed upon in the agreement between me and the company. Activities and Experience: Preparing estimates by performing take offs for windows and lighting provided a practical experience to the coursework in estimation. Master schedule, daily, weekly and monthly forecasts for a project was covered by scheduling and also the various processes that go into making the schedule more efficient like crashing were observed on site as well as from the perspective of a project manager. During the course of work, a proposal for standardizing the processes like material management on site, preparing punch lists and work force management were proposed by me which are implemented or in the stage of implementation after review, this is intended to improve productivity and an attempt to embrace lean principles in the organization. During the biding process, the interactions with the bidding contractors and the negotiations we conducted was application of negotiations in competitive environment. Processing the change orders, preparing the scope of work, work schedule, contract agreement and schedule of values would act as a perfect foundation for contracts and risk management. Company operations were observed and
  • 24. Reagan s Role During The Demise Of The Soviet Union Reagan s Role in the Demise of the Soviet Union Entering into the 1980s, the Soviet system was already in deep trouble. In order to match the US arms arsenal, it had put itself in a position, whereby the Soviet economy was finding it difficult whether to first put bread on the table of a common Russian or to match US in a tit for tat response. Though Gorbachev s intentions were to strike a deal with the United States in order to put a halt to the arms race, which was straining the Soviet economy at the seams; however, Reagan kept the pressure of the SDI or the Star Wars programme on the Russians. He also encouraged Gorbachev to introduce more reforms, which resulted into Glasnost and Perestroika. Reagan s famous speech at the ... Show more content on Helpwriting.net ... In my view, Gorbachev s trust on Reagan came to a point where he was ready to take the leap of faith and that ensured a peaceful outcome of the cold war endgame. This all shows that how powerful impact the Summits can have on the psyche of a leader of a nation. By the time Reagan had gone, USSR unilaterally announced the cut in its defence arsenal in 1989, the Warsaw pact countries were moving towards democratization and finally in December 1991 saw the final enactment of the dissolution of the Soviet Union. Reykjavik Summit, October 1986: Reagan Gorbachev (Gorbachev proposed phasing out nuclear weapons in return for US abandonment of SDI) Although the Geneva summit was not a success, however it gave the opportunity to both the leaders to size each other up. 1986 was not an easy year for Michael Gorbachev. When Ronald Reagan proposed that the next two meetings should be held in Washington and Moscow, Gorbachev forcefully demanded that a substantial Arms Control agreement should be signed. However Reagan did not want to give the impression that in order to have a meeting with Gorbachev, he had given concessions to him. Reagan therefore, refused to commit on an arms control agreement in the following meeting. However in January 1986, Gorbachev made an offer to Ronald Reagan which he could not refuse. In January of that year, Gorbachev
  • 25. Clinical Supervision Model Supervisors provide effective formative and summative feedback, promote growth and self assessment in the trainee, and they also have to be able to conduct their own self assessment. These skills encourage the trainee in the process of supervising. Clinical supervision is defined as: An intervention that is provided by a senior member of a profession to a junior member or members of that profession. This relationship is evaluative, extends over time and has simultaneous purposes of enhancing the professional functioning of the junior member(s), monitoring the quality of professional services offered to the clients she, he or they see(s) and serving as a gatekeeper for those who are to enter the particular profession (Bernard Goodyear,... Show more content on Helpwriting.net ... Counselors have a responsibility to monitor their effectiveness, in order to do this they need someone who is trained to assist them in understanding what is effective. Counselors have to seek supervision when appropriate and in order to do so a program needs to be in place that has supervisors readily available. The absence of clinical supervision may lead to counselors in training to lack the necessary skills to be a successful and productive counselor. Counselors need to develop a comprehensive understanding of the setting, population, needs, contexts and tasks of a counselor. As explained by Milne and Oliver (2000), Clinical supervision is central to initial professional training and to continuing professional development. It is necessary for counselors in training to refine their skills and get assistance in applying theories to any issues they may encounter with their clients. In addition to the everyday assistance necessary, a supervisor needs to present/model ethical behavior and counseling practices. In any profession the need for improvement is prominent and therefore any assistance and feedback given is appreciated and necessary. Expectations are increasing and therefore supervision is expected. Evidence shows that supervision results in school counselors increased effectiveness and accountability, improved professional development, and improved job performance, confidence, and comfort
  • 26. Dinosaurs And Birds Essay Dinosaurs and Birds Are birds really dinosaurs or are they simply related? That is a question that has gained new life in recent years due to the overwhelming facts the are pouring in from newly found fossils and studies from fossils that have been found in the past. Two groups have formed in the study of this question: those who believe birds are a direct result of dinosaurs and those who feel dinosaurs and birds must have had a common ancestor. Determining which view is correct is a matter of opinion based on fact. The main problem involves the use of cladistics or phylogenetic systematics to group organisms according to characteristics they share. When one looks at dinosaur fossils, he or she may feel that certain ... Show more content on Helpwriting.net ... Also, support is gaining that Archaeopteryx was not in fact the first bird, but instead a descendent of an earlier bird ancestor that had developed along a different pathway and actually represents an evolutionary dead end. Two opponents of the birds are dinosaurs theory are Alan Feduccia of the University of North Carolina and Larry Martin of the University of Kansas. They believe that birds evolved from some unknown reptile from a time before dinosaurs came to be. One point they make is that flight must have begun from tree climbing or an arboreal ancestor but that all the proposed dinosaurian ancestors were ground dwellers or cursorial On the other side, supporters for the birds are dinosaurs theory feel there is an unknown dinosaur bird that was arboreal, or simply that birds evolved flight from the ground by chasing after insects. In recent years other fossil finds have stirred the argument even more. One of these is the fossil named Sinosauroptyrex found in China. It appears to be an important link between birds and dinosaurs. Sinosauropteryx appears to be a feathered dinosaur having a mane of feathers along its neck, back, and tail a feature until then seen only in birds. Sinosauroptyrex appears before Archaeopteryx and gives a substantial link between the theropods and birds. One opponent of this find is Martin who feels the
  • 27. The Issue Of Reproductive Rights The topic of reproductive rights surrounding women in Texas has been a hot buttoned issue since the closing of many reproductive centers across the state. Recently damaging abortion restrictions were passed and therefor encroach on women s reproductive rights even more by decreasing access to abortion care. Texas 84th Legislature, both passed HB 3994 as a law and had it Governor Abbott make it effective with his signature on July 8, or this year. This law complicates access to abortionservices for mistreated and neglected minors and for those who do not possess specific identification cards in Texas. Specifically HB 3994 has four requirements of the bill that would explicitly hinder Latina minors. The first provision it that the bill will make it harder for a minor to demonstrate that she needs a judge to approve her for an abortion because the level of evidence that the minor must acquire is much more encompassing. Secondly, it revises the requirement that a judges rule must be made immediately, expanding the decision time from two days to five and prolonging the process. The third provision withdrawals the requirement that in the case the judge cannot make an immediate rule, then the minor s case was automatically granted. This third provision along with the extension of the ruling time, could lead to a number of rules not being made and to the possibility of the minor s application being denied. Fourthly, the new bill brings limits on who can have their appeals heard
  • 28. Ethical Issues In District 9 District 9 is a movie about aliens that come to Earth; they settle in Johannesburg till they are made to relocate to another area and troubles arise from there. The movie was released in 2009 and the time period of the movie is the year 1982 and 2009. It was a period of time when South Africa was going through a lot of problems and these problems are reflected in District 9. Racial discrimination, segregation, xenophobia and others are real life issues and moral issues reflected in the film. The most obvious issue reflected in the movie is xenophobia and the treatment of these foreign refugees. In the movie, the alien spacecraft is stranded in Johannesburg and the government takes care of the malnourish aliens onboard. In real life South Africa, Zimbabweans, refugees seeking refuge flood the country. These refugees face discrimination by the locals and they are treated like dirt. ... Show more content on Helpwriting.net ... Apartheid was a social and political policy by the white minority government. Everyone was segregated by their racial groups, public facilities were exclusive to each race and they all lived far apart from each other. The movie was inspired by the apartheid regime in South Africa and is reflected in the movie. The aliens take refuge in the slums and then these slums are walled up and this is the only proper place for them to live in. The aliens live in separate areas from the humans, which is parallel to the apartheid policies in real life. There are signs everywhere in District Nine s Johannesburg which tells the aliens that the facilities in the city is for human usage and they cannot loiter and aren t welcome in shops. This is all true in real life South Africa. Black majority live in designated areas and public facilities have signs on them stating who can use it. Benches, beaches and toilets have signs on them that say blacks only showing that only black people can use
  • 29. STARS FIU Personal Statement Analysis List all your commitments, involvements, and organizations you will be involved with on campus and/or in the community during the 2015 2016 academic year. Student Poets Eloquently Articulating Knowledge (S.P.E.A.K.) Global Community Engagement Haitian Student Organization Photography club STARS FIU Cru Tell us the reasons why you are applying for these positions. I am applying to these positions mainly because I want to get involved and help organize the Relay for life at FIU next spring semester. In high school, I was an ambassador of the Relay for life event at my school. It was organized by the Debate Team, which I was part of. I had a wonderful experience. I would like to learn more about Relay for life and the American Cancer Society, while I volunteer my time and commit myself to this noble cause. I am truly passionate about raising money for cancer research; my step mother is a cancer survivor so in her honor and all of the cancer survivor around the world, I want to step forward and ... Show more content on Helpwriting.net ... What contributions can you make to the Relay for Life steering committee team? I feel that Relay for Life e board members or chair need to be strong, motivated and passionate about the cause. I feel that they need to commit to their responsibilities while working collaboratively to put the event together. They should be spontaneous, able to handle pressure and cope with stressful situation. I believe that all of the previously cited qualifications are needed in order for a a Relay for Life e board member or chair to work successfully. In the Relay for Life steering committee team, I believe that I can bring creativity, passion, new ideas and excitement about the projects that we plan along the way for the Relay for Life event. I know that I can help the Relay for Life steering committee team to plan a successful Relay for Life this year by putting a 100% effort into
  • 30. Information The Usage Pattern Of Open Accessing Electronic... USER SELECT AND TROUBLES IN OPEN ACCESSING E JOURNALS BY THE STUDENTS OF PROFESSIONAL INSTITUTE IN TRIPURA STATE, INDIA : A STUDY SOMA SARKAR Research Scholar, Department of Library and Information Science, Madurai Kamaraj University, Madurai 625 021 Tamilnadu, India Dr. K.CHINNASAMY Head, Department of Library and Information Science, Madurai KamarajUniversity, Madurai, Tamilnadu, India. ABSTRACT E Journals have great importance in libraries and amongst the library users. The present study has been undertaken with an attempt to information the usage pattern of open accessing electronic journals. The Profession students are mainly drawn from different parts of colleges in Tripura State. For that purpose, survey method has been adopted by the investigators, which comprises of administration of questionnaire, observation of the participants, and interview of some of the participants for knowing the opinion of the respondents in the respect of information of user accessing and troubles for accessing in open accessing electronic journals for their academic and research activities. The paper highlights the important survey findings in respect of user selecting pattern and accessing troubles towards the electronic journals. Key words: Electronic Journals, Open accessing e Journals, Selecting and Trouble Open Access e Journals INTRODUCTION The web has influenced the developments of new modes of scholarly communication including various discussion forum, websites and
  • 31. Copper Cycle Lab Report The Copper Cycle Alexes Montalvo Chem 1500 10 September 26, 2012 The Copper Cycle Introduction: The Copper Cycle is a popular experiment used to determine if an element, in this instance, copper, reverts to its elemental form after a chain of reactions. This experiment is very dangerous because of the reactions between the strong acids and bases. In this experiment I performed a series of reactions starting with copper metal and nitric acid to form copper (II) nitrate. Then I reacted copper and several other solutions such as, sodium hydroxide, sulfuric acid, ammonium hydroxide, and hydrochloric acid to form precipitates. In conclusion my percent recovery ... Show more content on Helpwriting.net ... If you see a deep blue color add more zinc powder until there is no change in color of the solution in the test tube. XI. Inside the fume hood, add a good amount of Hydrochloric Acid, HCl(aq), to the solution in the 250 ml beaker to remove excess zinc. (accelerate reaction by heating if the reaction appears slow) XII. Take the 250 ml beaker to your lab bench. Set up a gravity filtration with a plastic funnel, folded wet filter paper, and an Erlenmeyer flask. Pour the content in the 250 ml beaker slowly through the filter paper. Wash the filter paper with deionized water. Dispose of the filtrate in the proper labeled waste container. XIII. Carefully remove the copper metal from the filter paper onto the watch glass. (with a spatula) Place a 400 ml beaker on a hot plate contained with water. Carefully place the watch glass before the water boils to dry the copper metal. (Use the tongs to handle the hot watch glass) XIV. Record your observations of the dried, cooled copper metal and weigh the recovered copper. Data Collection and Observations: I started with elemental copper metal and then reactions occur step by step as follows: |Experimental stage |Observations | |1. Copper metal (penny) at the start |Tarnished, worn out, brownish, copper colored, fine solid. | |2.
  • 32. Mutli-Agent Based Modeling Multi Agent System/Agent Based Modeling Multi agent systems are among the methods used for modeling and simulating Natural Disaster emergencies. The terminology of Agent Based System tends to be used more often in the sciences and Multi Agent System in engineering and technology. The Agent Based System is gradually replacing the micro simulation techniques and object oriented simulation. Agent Based System has ability to capture different dynamic models which usually consist of simple entities or more complex entities. We have proposed a specific agent based methodological framework allowing, from modeling to simulation, the production of observables at different levels of details related to a Natural Disaster organization. A Multi Agent System can model the behavior of a set of entities. Agents have a degree of autonomy and are immersed in an environment in which and with which they interact. Modelers can use Multi Agent System to create computer representations of dynamic events such as Natural Disaster emergency. Therefore, the application of Multi Agent System in this area could help managers to experiment all possible scenarios of a disaster and assist them in making decisions. A multi agent based system is a powerful modeling technique for simulating individual interactions in a dynamic system and is distinctive in its ability to simulate situations with unpredictable behavior Earlier researches have focused on modeling of the rescue during Natural Disasters, but
  • 33. Wang Lung s Filial Dishonesty In The Good Earth The Good Earth is set in pre revolutionary rural China when women are inferior and elders are most important. Those who treat their daughters as equals and do not practice filial piety are considered outcasts. This is also a time when a man s life revolves around the Earth. Food is grown from the Earth and clothes are sewn from crops because nothing is made in a factory. Religion is based on Gods watching over the land. People also believe that the Gods will curse a bad man and reward a good one. If a man works the land diligently, remains honest, and practices good morals, he may be rewarded with wealth, health, and tranquility. Some people, however, do not work hard and live corrupt lives. As a result, they never experience either wealth,... Show more content on Helpwriting.net ... Wang Lung s uncle is very lazy and vicious. He is an unsuccessful farmer due to his idleness. Sometimes he sells his crops when they are still in the ground because reaping the harvests strip too much effort from the idle fool. Since he does not make much money from his harvests, he blames it on bad luck and depends on Lung for money. Since society operates in filial piety, Wang Lung has to give his uncle the money. Lung s uncle also participates in gang violence and cannibalism. He is not rewarded by the Gods. He did, however, have wealth and power by living in the House of Hwang with Wang Lung but only because Lung has to obey him. Lung s uncle never finds tranquility. He is never content with what he has. He is always striving for more in vicious and idle ways which cause his unfulfilling life. Wang Lung s cousin is also idle and vicious. He never learns to work and is very lusty. When he lives with Wang Lung s family, he introduces Lung s eldest son to prostitutes. He also flirts with his relatives and practices incest. He is not rewarded by the Gods because he is so vicious. Instead, he never lives a fulfilling life. When he grows up he abandons his wife and unborn
  • 34. Rebirth in Sylvia Plath s Lady Lazarus, Fever 103,... Rebirth in Lady Lazarus, Fever 103, Getting There, and Cut The Ariel period poems of Sylvia Plath demonstrate her desire for rebirth, to escape the body that was drummed into use by men and society. I will illustrate the different types of rebirth with examples from the Ariel poems, including Lady Lazarus, Fever 103, Getting There, and Cut. Lady Lazarus, the last of the October poems, presents Plath as the victim with her aggression turned towards her male victimizer (33). Lady Lazarus arises from Herr Doktor s ovens as a new being, her own incarnation, the victim taking on the powers of the victimizers and drumming herself into uses that are her own (33). Linda Bundtzen also sees the poem as an allegory ... Show more content on Helpwriting.net ... During the multiple orgasms of Fever 103, the delirious woman sublimates a body sick with desire into an acetylene virgin flame and thereby rids herself of any need for men to complete herself sexually; Thus, Plath freed herself from male dependency (Bundtzen 236). Two Ariel poems Cut and Getting There do not exhibit a full rebirthbut rather exploit the female body s victimization to mover towards new self perceptions (Bundtzen 247). In both poems the female body remains passive, acted upon by the mind s transforming powers (Bundtzen 247). In Cut the amputation of the thumb is a symbol of female castration; she became a dirty girl, unable to be a pure female any longer. Plath understands her self amputation as an acting out of her self hatred as a woman, she is deficient by virtue of her female wound (Bundtzen 247 248). The speaker is cut while doing her duty and she unconsciously tries to stop it by cutting off her finger. In Getting There, the speaker is a Jew in a box car on her way to a concentration camp. She identifies with all the wounded and dead: The tent of unending cries (Plath 248). What gives the speaker this solemn sympathy with the casualties of war is her female body. She knows these atrocities as a part of her very being, her genesis (Bundtzen 249): There is mud on my feet Thick, red and slipping. It is Adam s side, This earth I rise from, and
  • 35. Essay on How do the later war poets differ in their... How do the later war poets differ in their treatment of war from early war poets? World War I was noticeable for the vast amounts of poetry that was produced from many of the soldiers. The poets wrote vastly over the years 1914 1918 and they all expressed many different opinions. It was a way of getting their views across to other people. Some of the poems even made aware of the fact and the true horror of the war. During the first half of World War I, the poems that were produced had a very patriotic and glorious view to them. As the war progressed, the poems became more bitter as the true extent of what was really going on, was unveiled. Some of the poets we will be looking at include Wilfred Owen and Laurence Binyon. For ... Show more content on Helpwriting.net ... The Soldier has two versus to this poem. The first verse has eight lines and is called an octet; the second verse has six lines and is called a sestet. Therefore, this poem is a sonnet. It has a rhyme scheme of ABABCDCDEFGEFG. This gives the poem a regular flow and a constant beat. This is much easier for the reader to understand. Fall In is another patriotic poem yet again and this is shown throughout the poem. This poem has four versus and the rhyme scheme is ABABCDCDEFEFGHGH and continues like this until the end of the poem. This rhyme scheme has a regular and beat which makes the every second line of the poem stand out to the reader. The next poem we studied was Rendezvous written by Alan Seeger and it is quite a dull poem about death. This poem also is a personification, like For the Fallen . Only this time, the personification is of death. It, yet again, has a constant rhyme scheme. Only this time, it is very effective. Because the poem is a dull poem, the constant beat keeps the reader interested in the main topic of the poem. You could say, if you wish, that most of the pre war poems we have studied are very similar. They are patriotic and they promote the war. They also don t tell you what the war is really like. As the war progressed, the hideousness of the war became more apparent. With poets like Sasson being produced, people could see the war for what it really was. There were a number of poets that were
  • 36. Roman Patronage Essay In this essay, the topic to be discussed is that of patronage in the roman society. Aspects of this to be looked at are the relationship between patron and client as well as the roles and responsibilities of the two parties. Patronage in politics is another topic to be acknowledged within this essay. Work on this later Patronage was a mutual relationship between a man of wealth and influence, and a free client. This was a relationship that law acknowledged in the early ages of the 5th century BC and by 1st century BC it had become hereditary. However, patronage is said to have originated in the dim past, possibly in the early monarchy, this idea is prompted by this passage by Dionysius of Halicarnassus about the Roman founder: Romulus entrusted... Show more content on Helpwriting.net ... Therefore, the more clients a patron gathered, the better it was for their political stance. And if a patron were able to gain a large portion of political clients, they could retrieve power through both votes and by infiltrating every political group and influencing all their loyal clients. Therefore, the practice in politics used by patrons over their clients was of importance in the voting attended in the public assemblies under the republic. Another aspect to be seen was that clients and patrons were not to go against each other in court, perhaps due to another statement from Dionysius s passage with It was unlawful and unholy for patricians and clients to bring suit against one another, to testify against one another in court, or to vote against the other. Thus emphasizing the laws in place when clients and patrons were associated with politics and the court. An example of a patron could be Augustus, due to when Augustus became First Citizen, he desired to be treated as a father or a patron by the Roman world. In this, he brought about the patronage system. Through it, he acquired many writer clients, for the writers, they gained a large market and large financial support, and for Augustus it would promote his own personal
  • 37. The Acidic Environment Around Us The environment around us is certainly acidic. Even though people often think the air around us is neutral, the atmosphere naturally contains acidic oxides of carbon, nitrogen and sulfur that can harm our environment greatly. These oxides can be produced naturally and industrially. Sulfur dioxide is produced when organic matter decomposes and forms hydrogen sulphide which then oxidises to the oxide: 2H2S (g) + 3O2 (g) 2SO2 (g) + 2H2O. The natural sources of sulfur dioxide are in volcanic gases, bushfires, sulfur rich geothermal hot springs releasing gases and the decomposition of organic matter. The industrial sources of sulfur dioxide such as in processing and burning of fossil fuels and extracting metals from sulfur rich ores such as smelting of galena for lead: 2PbS (s) + 3O2 (g) 2PbO (s) + 2SO2 Nitric oxide is another oxide in the atmosphere that is formed when nitrogen and oxygen react due to high temperatures of lightning: N2 (g) + O2 (g) 2NO (g). Other sources of nitric oxide from industrial sources include the combustion of fossil fuels both in cars and in power stations. The nitrogen in the air reacts with oxygen in the hot engines. Another oxide that occurs in the atmosphere is nitrogen dioxide which is produced after nitric oxide is produced by lightning and reacts with the oxygen in the air: (2NO (g) + O2 (g) NO2 (g)), it is also released in large volumes in the atmosphere by power stations. Nitrous oxide is an oxide that occurs on root nodules of legume
  • 38. India Business Quiz India Business Quiz : Questions with Answers 1. We have learned that if we provide people with an occasion amp; an excuse to shop, they will come are the Golden words of whom? Ans: Kishore Bayani (The Chairman of Future Group) 2. What is the Title of Auto Biography of JRD TATA? Ans: Beyond the Last Blue Mountain 3. What is the Title of Auto Biography of Krishna Kumar Birla? Ans: Brushes with History 4. It happened in India is the Auto Biography of whom? Ans: Kishore Bayani (The Chairman of Future Group) 5. The End of Ecconomic Man is the famous book written by whom? Ans: Peter F Drucker 6. Imagining India recently published book authored by? Ans: Nandan M Neelakeni 7.... Show more content on Helpwriting.net ... IMF stands for International Machinery Fund International Monetary Fund Indian Machinery Fund Indian Monetary Fund3. SEC means.. Securities amp; Exchange Commission Stock Exchange Commission Script Exchange Commission Special Exchange Commission4. NSE stands for National Stock Exchange National Script Exchange Network of Stock Exchange Non Stock Exchange5. NYSE is is acronym for New York Stock Exchange New York Scripts Exchange New York Special Exchange National York Securities Exchange6. NSDL stands for Network of Securities Depository Limited Network of Stocks Directory Listing National Stock Directory Limited National Securities Depository Limited7. ADR stands for All Depositary Receipt Asian Depositary Receipt African Depositary Receipt American Depositary Receipts8. In the context of Mutual Funds, SIP stands for.. Systematic Investment Plan Scheduled Interest Plan Specific Insurance Plan Special Income Plan9. In the context of Mutual Funds, ELSS means Endowment Linked Savings Scheme Equity Linked Savings Scheme Established Line Savings Scheme Entrepreneur Line Savings Scheme10. AMFI stands for Association of Mutual Funds in India Arbitrated Mutual Funds India Arbitrated Monetary Funds India Associated Mega Finance of India| 1. Financial Statements are reports on
  • 39. Marketing Plan For A Marketing Question #1: Develop a brief marketing plan for the event of your choice. Make sure to identify the competitive advantages, target market(s), strategies, tactics, budgets, and schedule and evaluation methodologies. Describe how you will increase your marketing performance through creative and innovative tactics. Answer: To promote the promotional event of Frizzy Drink, I will use certain strategies and a particular way for the marketing plan. The marketing plan will cater few things that will help the product in getting recognition. By adopting few of the significant steps, the marketing plan would be very useful to promote the event Pricing: The pricing of the product is the most important part in marketing plan to promote the product in the event. Price of the product should be according to the customers and the budget and costing of the product. Do not demand excessive profit, it will lessen the demand of the product. The budgeting of the product is also very important in pricing. Never use excessively expensive products that will increase the product rate and customers feel reluctant in buying it due to high prices. $3 to $4 would be very appropriate for the price of per unit. Proper Marketing of the Product: Proper marketing plan will ensure in making the product successful. Campaigns would be carried out to promote the frizzy drinks on different forums including public recreational areas, malls and offices. The event will cater a proper marketing strategy in which the
  • 40. College Dropout Boom Summary For the Topic of the College Dropout Boom , David Leonhardt makes interesting points on the topic of education and society s views on education. Some of the ideas that he presented were debatable in my opinion, but most every point that he addressed was correct. Growing up in a household where both of my parents achieved a collegeeducation, I can personally say it extremely important in this day and age to get a college degree, regardless of the immediate outcome. It will give you an immense edge on the competition that you will face while applying for jobs in the future. One of the most engaging points that Leonhardt makes is the belief that someone s economic class will greatly impact their decision on whether or not to go to college. This ... Show more content on Helpwriting.net ... There are scholarships and financial aid that you can apply for that can help you throughout college, so there is no excuse behind saying that if you come from a poor background that you can t get a college education. Another interesting point that Leonhardt makes is that the American Dream is lost and the chances for economic mobility have diminished over the past the few decades, which I agree. I truly believe that the American Dream is still there; it s just a lot tougher than it used to be to achieve your goals. My generation is very competitive when it comes to school and getting into college. It s not as it once was back in the day when my parents were growing up. Those bound for school in those years planned on going to school nearby home and believed that a school in the radius of 300 miles away from home is too far for them. They believed that applying to one or two schools was enough, and also the acceptance rate was mostly very high. It used to be simple, but not anymore. Now we have students that are coming from all around the world to get an education in the United States with competitive grades and impressive high school transcripts. With the increase of applicants to
  • 41. The Devil And Tom Walker Imagery Analysis Imagery is used to help create a more imaginative and well developed story. These stories started to become more popular during the time of the Romantic and Transcendentalist. Washington Irving was an extremely popular author during this time, who was also an author that stretched and tested the limits of past authors styles, as well as creating his own new style. Washington Irving s short storyThe Devil and Tom Walkeris a retelling of a Germanic Faust legend. In the story Tom Walker finds himself in a deep in the forest and comes face to face with the Devil. The Devil tries to make an agreement with Tom, this agreement will make Tom extremely rich. Tom ruminates over the choice he is given. His wife avidly wants him to accept the proposal... Show more content on Helpwriting.net ... Irving theme in this short story is that all action have consequences. In the story Tom tries to trick the Devil by becoming more pious that others who have religious their entire lives. However, it does not work, because one day the Devil comes back for Tom holding a black horse, which neighed and stamped with impatience (Irving 359). This small segment of imagery supports the theme, because the horse is anxious and impatient as if it has waited a long time to be here and take Tom away to what he deserves. The reader can imagine a horse that is rearing and ready to go. It demonstrates that even if Tom protected himself for a little while the Devil still came back to dispense the consequences for the deal he and Tom made together. Tom worked as a usurer to gain a large fortune that he wanted, just so he could flaunt it in an ostentatious manner. However he wanted to get this money easily by bartering with the Devil to find an agreement that made him rich quickly. He did get this money but he suffered consequences because of it, and when the black horse swept him away all of his earthly treasure disappeared as well. All his bonds and mortgages were reduced to cinders , his chest of gold and silver was filled with chips and shavings , and where his two horse were two skeletons lay in his stable (Irving 359). He was never able to enjoy the money he made, because of the actions he took to gain it. On the other hand, Tom never did enjoy his money, because of his stingy nature. Tom wanted all the money he could get his hands on, but he never wanted to spend a dime. In addition with the added fear of the Devil coming at any time Tom was always on edge and at peace. He made a deal with the Devil and the Devil made him suffer the consequences of his actions. Old Scratch and his black horse carried him off after Tom agonized under the unknown time the Devil s return.
  • 42. Little House Of The Big Woods By Laura Ingalls Wilder Little House in the Big Woods by Laura Ingalls Wilder is a historical fiction book because although much of what the author writes about are memories of her childhood while growing up in the Big Woods of Wisconsin some of the stories and characters were added or embellished. This story tells of Laura Ingalls and her family and how life was for them in the Big Woods in the early 1870s. Survival was not always easy for them but life was rewarding. For the Ingalls, survival meant growing and harvesting their own crops, raising their own cows and chickens for eggs, milk and butter, Pa hunted all summer and stored away enough food for the harsh winters and almost everything the Ingalls wanted or needed they had to get and make themselves. At... Show more content on Helpwriting.net ... A woman named Sarah from Maine answers Jacob s ad and comes out to visit and see if things would work between the two of them. The children, Anna and Caleb are very excited to have a woman around again, but Sarah misses the ocean and the beauty of Maine. Sarah and Jacob make a connection but the children worry their dad and themselves are not enough to keep Sarah with them. Ultimately the hardship and ruggedness of farm life don t matter to Sarah because she has grown to love the Witting family and decides to marry Jacob and stay forever. Anne of Green Gables by Lucy Maud Montgomery is a historical fiction book because it is set in the 1880s on Prince Edward Island after Matthew and Marilla, an elderly brother and sister adopt a boy to help around the farm but instead get Anne. Anne is a spunky 11 year old who is not afraid to speak her mind. Matthew and Anne connect and he decides he wants to keep her even though she is a girl. Anne doesn t act proper like most young girls of her time but goes on adventures and gets in a fair amount of mischief. She gains the attention of a boy named Gilbert but she is not a fan of him after he calls her carrots because of her red hair. Eventually Anne warms up to Gilbert and even starts to have feelings for him. Anne is very smart and at 15 she decides she wants to be a teacher. She earns her teaching license in only one year instead of usual two years and is offered a scholarship
  • 43. Facts About The Movie Gladiator The movie Gladiator is based on a fictional storyline that takes place during the time of Ancient Rome. After having learned about Ancient Rome and the fashions of that time, I can say that the film Gladiator had both accurate and inaccurate representations of Ancient Roman fashion throughout. Some of the costumes, hair and makeup shown in the movie were accurate, while others were not. Janty Yates was the costume designer for Gladiator. There were certain aspects of the costumes in this filmthat she did accurately according to the clothing worn in Ancient Rome. In the movie, Maximus and the other slaves and prisoners of war were seen wearing light blue and/or beige tunics. As mentioned in the video lecture, tunics were extremely important in Ancient Romefor both men and women and would continue to be in the years to come. Men wore them under their togas and women wore them under their stola. Tunics on men and women were both shown in Gladiator throughout the film. Toga trabea were seen early on in the film and were worn by the emperor Caesar, and then by his son Commodus after he killed his father. The toga trabea that they wore were purple which was historically correct since only the Emperor and his sons were allowed to wear it. Their toga were also embroidered intricately which showed their high status. However, I did come across a few anachronisms regarding the color purple. In the scene where Maximus... Show more content on Helpwriting.net ... This was not covered in the textbook or in the video lecture, and was not commonly seen in Ancient Rome. I also noticed that when Maximus was captured as a prisoner of war many men around him were wearing turbans on their heads, which was also not seen in Ancient Rome. However, hair and makeup in the film were accurate for the most part. Most of the men in the film had the Caesar cut that was mentioned in the video lecture, and the women had elaborate
  • 44. Human Morphology 88. Although these molecules allow some radiations at visible wavelengths, where most energy of sunlit is concentrated, to pass through, they absorb some of the loneger wavelength, infrared emissions radiated from the Earth s surface, radiation that would otherwise be transmitted back into space. 89. The role that anthropologists ascribe to evolution is not of dictating details of human behaviors, but one of imposing constrants ways of feeling, thinking and acting that come naturally from architypal situations in any human cultures. 90. The role these anthropogists ascribe to evolation is not of dictating the details of human behavior, but one of imposing constrains ways of feeling, thinking and acting that come naturally in archetypal situations in any cultures.... Show more content on Helpwriting.net ... 92. Which of the following most probably provides an analogy from human morphology for the details verses constrains distinction made in passage in relation to human behaviors? 93. A low number of algal cells in the present of a high number of grazers susgested, but did not prove, that the grazers had removed most of the algae. 94. A low number of algal cells in the present of a high number of grazers suggested, but did not prove, that grazers had removed the most numbers of