AlbaniaDreamin24 - How to easily use an API with Flows
2017 02 apan
1. Big data changes science, radical transparency is
necessary
Delhi, 2017-02-17Johannes Keizer, GODAN Secretariat
2. • GODAN Secretariat
Partnerships Lead
• Before: Team Leader at FAO for
open Access and open Science
• Background: Research,
Pesticide Chemistry
Johannes Keizer, PhDTHE PRESENTER
johannes.keizer@godan.info
4. ●Doubling food production
for feeding 9 billion
●Knowledge Economy
●Data Intensive Science
●Open Access
●Key words !!
5. “… research suggests that seven sectors alone could
generate more than $3 trillion a year in additional value
as a result of open data, which is already giving rise to
hundreds of entrepreneurial businesses and helping
established companies to segment markets …”
Source: McKinsey Global Institute
"Making these data public will allow people to
make their own assessments of the progress of
our Good Growth Plan. It is also blurring the
traditional roles of business, government and
NGOs by highlighting our collective
responsibility to address acute global
challenges. Above all, the data will be of value
to farmers, enabling them to increase
productivity sustainably and to enhance their
livelihoods."
"Open data has the power to solve our most
challenging sustainability problems. … Agri-
tech businesses have a big role to play in
finding novel solutions to these problems. …
Syngenta is taking a step that puts them at
the forefront of the open data movement in
their sector. We look forward to working with
them to unlock benefits for farmers and
consumers worldwide."
Mike Mack, CEO of Syngenta
(2015, for 1st GGP data release)
Jeni Tennison, Deputy CEO and CTO of
the Open Data Institute
There is Hype
6. Internet usage:
40% of global population
– 2.26 billion
Developing countries:
from 0-30% in 16 years
On linear trend, 100% in
just 22 years. Goal of
UN to have 50% by
2015. Achieved 34%
Philippines ranked above
US in 2015
A game changer?
7.
8. Daunting challenges - impressive opportunities:
• The life science revolution is changing
our understanding of the fundamental
biology of plants, animals and people. It
is transforming agriculture.
• Information revolution approaches are
critically transforming the retail end of
food value chains- radical transparency.
9.
10.
11. New tools allow us to look in new places for sources
of variation – including wildlife
Comparative gene network
and sequence analysis allows
to ask new kinds of questions
about genomes – eg “what is
different about this (group of)
species compared to all other
mammals”
“traditional” linkage mapping requires crosses – so initial discovery is
limited to variants within a species
Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK
Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK
Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK
Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK
Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER
Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
12.
13.
14.
15. Data against death
• Discovering patterns of gene
expression during aging
• Craig Venter and others sift
through genomic data on a vast
scale
• Matching genetic expression
with physiologica patterns
16. Sequencing machines + Gene editing + Big data analysis
Drones &satellites + AI picture processing + Big data analysis
Revolutionary processes, examples
17. Paradigm Shift for research
• In the past
– 80% data production, 20% data
evaluation
• In the future
– 20% data production, 80% data
evaluation
18. If networked science is to reach its potential,
scientists will have to embrace and reward the open
sharing of all forms of scientific knowledge, not just
traditional journal publication.
Networked science must be open science.’
Michael Nielsen (OKI)
26. Challenges
• “Open data is good only for the big
players”
• “Open data will create more data
monopolies and divides”
• “This research data is only meaningful
in specific context [and only I
understand that…]”
• “Somebody has to pay!”
28. GODAN addresses Issues through
working groups
• i.e. data rights and responsibilities
• i.e. data infrastructure
• i.e. better technical, semantic and
legal interoperability
• i.e data gaps in nutrition
29. “I went through this Responsible Data in Agriculture brochure that’s
online and it strikes me how much it applies, in concrete terms, to
the data revolution that is part and parcel of the 2030 agenda for
sustainable development.” Thomas Gass, UN-DESA
34. It is worthwhile to become GODAN
partner !!!!!
We have to be thousands to make enough
pressure on opening data!
(list to be revised)
● Participate to discuss and resolve open
questions
● Learn from successes (and failures of others)
● Bring your issues to the broader community
● Become a GODAN champion and influence the
community
● Use the GODAN context to find new Grants for
open data
35. Join GODAN!
● Sign up means you agree to our principles
in our Statement of Purpose
http://www.godan.info/about/statement-of-
purpose/
● Easy to complete forms online
http://www.godan.info/partners/become-a-
godan-partner/
● Talk to us about how you can get involved in
our events, publications and working groups